KEGG   Rattus norvegicus (rat): 25569Help
Entry
25569             CDS       T01003                                 

Gene name
Trh, Pro-TRH, THR, TRH01, Trf
Definition
(RefSeq) thyrotropin releasing hormone
  KO
K05253  thyrotropin-releasing hormone
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25569 (Trh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRH
Motif
Other DBs
NCBI-GeneID: 25569
NCBI-ProteinID: NP_037178
RGD: 3903
Ensembl: ENSRNOG00000011824
UniProt: P01150 B1WBP2
Position
4q34
AA seq 255 aa AA seqDB search
MPGPWLLLALALIFTLTGIPESCALPEAAQEEGAVTPDLPGLENVQVRPERRFLWKDLQR
VRGDLGAALDSWITKRQHPGKREEEEKDIEAEERGDLGEGGAWRLHKRQHPGRRANQDKY
SWADEEDSDWMPRSWLPDFFLDSWFSDVPQVKRQHPGRRSFPWMESDVTKRQHPGRRFID
PELQRSWEEKEGEGVLMPEKRQHPGKRALGHPCGPQGTCGQTGLLQLLGDLSRGQETLVK
QSPQVEPWDKEPLEE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccgggaccttggttgctgctggctctggctttgatcttcaccctaactggtatccct
gaatcctgcgccttgccggaggcagcccaggaggaaggtgcagtgactcctgaccttcct
ggcctggagaatgttcaggtccggccagaacgtcgattcttgtggaaagacctccagcgg
gtgagaggggacctcggtgctgccttagactcctggatcacaaaacgccagcatccaggc
aaaagggaggaggaggaaaaagacattgaagctgaagagaggggagacttgggagaaggg
ggagcctggagactccacaaacgacagcaccccggccgacgtgccaaccaggacaagtat
tcatgggcagatgaggaggacagtgactggatgccacggtcctggttaccagatttcttt
ctggattcctggttctcagatgtcccccaagtcaagcggcagcaccctggcaggcgatcc
ttcccctggatggagtctgatgtcaccaagaggcaacatccaggccggaggttcatagat
cccgagctccaaagaagctgggaagaaaaagagggagagggtgtcttaatgcctgagaaa
cgccagcatcctggcaaaagggcattgggtcatccctgtgggccccaggggacttgtggt
caaacaggcctgctccagcttctaggtgacctgagcaggggtcaggagaccctggtgaag
caaagcccacaagtggaaccctgggacaaggaacctctggaggagtaa

DBGET integrated database retrieval system