KEGG   Rattus norvegicus (rat): 25581Help
Entry
25581             CDS       T01003                                 

Gene name
Psmc2, MSS1
Definition
(RefSeq) proteasome 26S subunit, ATPase 2
  KO
K03061  26S proteasome regulatory subunit T1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    25581 (Psmc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    25581 (Psmc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    25581 (Psmc2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     25581 (Psmc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 AAA_28 AAA_2 RuvB_N AAA_7 AAA_18 Sigma54_activ_2 AAA_33 DUF815 Mg_chelatase TIP49 AAA_24 IstB_IS21 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 25581
NCBI-ProteinID: NP_150239
RGD: 3428
Ensembl: ENSRNOG00000012026
UniProt: Q63347
Structure
PDB: 

Position
4q11
AA seq 433 aa AA seqDB search
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIPV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccggattacctaggtgcagaccagcggaaaaccaaagaggatgagaaggacgacaag
cccatccgagctctggatgaaggggatatcgccttgttgaaaacttatggccagagtact
tattcgaggcagatcaagcaggttgaagatgacattcagcaacttcttaaaaaaattaat
gagctcactggtatcaaagagtccgacactgggctggcccctccagccctctgggatttg
gctgcagacaaacagacacttcagagtgaacagccgctacaggttgcaagatgtaccaag
ataatcaacgccgattcagaggacccgaaatacatcatcaacgtgaagcagtttgccaag
ttcgtggtggatctcagtgatcaggtggcacctactgacattgaggaagggatgagagtc
ggcgtggacagaaataaataccaaattcacattccactgcctcctaagattgacccaaca
gttaccatgatgcaggtggaggaaaaacctgatgtcacatacagtgacgttggtggctgt
aaggaacagattgagaaattgcgggaagtggttgaaacccctctactccatccagagagg
tttgttaaccttggaatcgagcctccgaagggtgtgttgttatttgggccaccaggcaca
ggcaagaccctctgtgccagggcagtggccaatcggactgatgcttgcttcatcccagtt
atcgggtctgagcttgtacagaagtacgtcggtgagggggctcgaatggttcgggagctt
tttgaaatggccaggacaaaaaaagcctgccttattttctttgatgaaattgatgccatt
ggaggggctcggtttgacgatggcgctgggggtgacaatgaggtgcagaggaccatgttg
gagctcatcaatcagctggatggctttgatcctcggggcaacatcaaagtgctcatggcc
actaaccgacctgatactctggacccagcgctgatgaggccagggaggctggacagaaag
attgagttcagcttacctgacttagagggtcgaacgcacatctttaagattcatgctcgc
tcaatgagtgtggaaagagacatccgatttgagctactagcccgcctgtgtccaaacagt
actggagcggagattagaagcgtttgcacagaggctggtatgtttgcaatccgagcccgg
agaaagattgctacagagaaggacttcttagaagctgtaaataaggtcatcaagtcgtat
gccaaatttagtgctactccccgctacatgacatacaactga

DBGET integrated database retrieval system