KEGG   Rattus norvegicus (rat): 25589
Entry
25589             CDS       T01003                                 

Gene name
Kdr
Definition
(RefSeq) vascular endothelial growth factor receptor 2 precursor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25589 (Kdr)
   04014 Ras signaling pathway
    25589 (Kdr)
   04015 Rap1 signaling pathway
    25589 (Kdr)
   04370 VEGF signaling pathway
    25589 (Kdr)
   04020 Calcium signaling pathway
    25589 (Kdr)
   04151 PI3K-Akt signaling pathway
    25589 (Kdr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25589 (Kdr)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25589 (Kdr)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25589 (Kdr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25589 (Kdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25589 (Kdr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25589 (Kdr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25589 (Kdr)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   25589 (Kdr)
CD molecules [BR:rno04090]
 Proteins
  25589 (Kdr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C2-set_2 Ig_5 Ig_4
Other DBs
NCBI-GeneID: 25589
NCBI-ProteinID: NP_037194
RGD: 2965
Ensembl: ENSRNOG00000046829
UniProt: O08775
Position
14
AA seq 1343 aa
MESRALLAVALWFCVETRAASVGLPGDSLHPPKLSTQKDILTILANTTLQITCRGQRDLD
WLWPNTPRDSEERVLVTECGDSIFCKTLTVPRVVGNDTGAYKCFYRDTDVSSIVYVYVQD
HRSPFIASVSDEHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRISWD
SEKGFTIPSYMISYAGMVFCEAKINDETYQSIMYIVLVVGYRIYDVVLSPPHEIELSAGE
KLVLNCTARTELNVGLDFSWQFPSSKHQHKKIVNRDVKSLPGTVAKMFLSTLTIDSVTKS
DQGEYTCTAYSGLMTKKNKTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYPAP
DIKWYRNGRPIESNYTMIVGDELTIMEVSERDAGNYTVILTNPISMEKQSHMVSLVVNVP
PQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPSQTNPYTCKE
WRHVKDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERVIS
FHVIRGPEITVQPATQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPVCK
NLDALWKLNGTVFSNSTNDILIVAFQNASLQDQGNYVCSAQDKKTKKRHCLVKQLVILER
MAPMITGNLENQTTTIGETIEVVCPTSGNPTPLITWFKDNETLVEDSGIVLKDGNRNLTI
RRVRKEDGGLYTCQACNVLGCARAETLFIIEGAQEKTNLEVIILVGTAVIAMFFWLLLVI
VLRTVKRANEGELKTGYLSIVMDPDELPLDERCERLPYDASKWEFPRDRLKLGKPLGRGA
FGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGA
CTKPGGPLMVIVEFCKFGNLSTYLRGKRNEFVPYKSKGARFRSGKDYVGELSVDLKRRLD
SITSSQSSASSGFVEEKSLSDVEEEEASEELYKDFLTLEHLICYSFQVAKGMEFLASRKC
IHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTI
QSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWH
EDPNQRPAFSELVEHLGNLLQANAQQDGKDYIVLPMSETLSMEEDSGLSLPTSPVSCMEE
EEVCDPKFHYDNTAGISHYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDSQTDSGMVL
ASEELKTLEDRNKLSPSFGGMMPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSDEA
GLLKLVDVAGHVDSGTTLRSSPV
NT seq 4032 nt   +upstreamnt  +downstreamnt
atggagagcagggcgctgctagctgtcgctctgtggttctgcgtggagacccgagccgcc
tctgtgggtttgcctggcgattccctccatccacccaagctcagcacacaaaaagacata
cttacaattttggcaaatacaacccttcagattacttgcaggggacagagggacctggat
tggctttggcccaacactccgcgtgactctgaggaaagggtgttggtgactgagtgtggc
gacagtatcttctgcaagacactcacagttcccagagtggttggaaatgatactggagcc
tacaagtgcttctatcgggacaccgatgtctcctccatcgtttatgtctatgttcaagat
cacaggtcaccattcatcgcctctgtcagtgacgagcatggcatcgtgtacatcactgag
aacaagaacaaaactgtggtgatcccatgccgagggtcgatttcaaacctcaacgtgtca
ctttgtgctaggtatccagaaaagagatttgttccggatggaaacagaatttcctgggac
agcgagaaaggctttactatccccagttacatgatcagctatgccggcatggtcttctgt
gaggcaaagattaatgatgaaacgtatcagtctatcatgtacatagttctggttgtagga
tataggatttatgatgtggtcctgagcccccctcatgaaattgagctatctgccggagaa
aagcttgtcttaaattgtacagcaagaacagagctcaacgtggggcttgatttcagctgg
caattcccgtcctcaaagcatcagcataagaagattgtaaaccgggatgtgaaatccctt
cctgggactgtggcaaagatgtttttgagcaccttgaccatagacagtgtgaccaagagt
gaccaaggagaatacacctgcacagcgtacagtggactgatgaccaagaaaaataaaaca
tttgtccgagttcatacaaaaccttttattgcttttggtagcgggatgaaatctttggtg
gaagccactgtgggcagccaagtccgaatccctgtgaagtatctcagttacccagctcct
gatatcaaatggtacagaaatggacgacccattgagtccaattacacaatgatcgttggt
gatgaactcaccatcatggaagtgagtgaaagagatgcgggaaactacacggtcatcctc
accaatcccatttcaatggagaaacagagccacatggtctctctggttgtgaatgttcca
ccccagatcggtgagaaagccttgatctctcctatggattcctaccagtatggcaccatg
cagacgctgacatgcacagtctatgccaaccctcccctgcaccacatccaatggtactgg
cagctagaagaagcatgctcctacaggcccagccaaacaaacccatatacttgtaaagaa
tggagacacgtgaaggatttccaggggggaaataagatcgaagtcaccaaaaaccaatat
gccctaattgaaggaaaaaacaaaactgtaagtactctggtcatccaggctgccaacgtg
tccgcattatacaaatgtgaagccatcaacaaagcaggacgaggagagagggtcatctcc
ttccatgtgatcaggggtcctgaaattactgtccagcctgctacccagccaaccgagcag
gagagtgtgtctctattgtgcactgcagatagaaacacgtttgagaacctcacgtggtac
aagcttggctcacaggcaacatcggtccacatgggcgaatcactcacaccagtttgcaag
aacttggacgctctttggaaactgaatggcaccgtgttttctaacagcacaaacgacatc
ttgattgtggcattccagaatgcctccctgcaggaccaaggcaactatgtctgctctgct
caagacaagaagaccaagaaaagacattgcctagtcaagcagctcgtcatcctagagcgc
atggcacccatgatcactggaaatctggagaatcagacaacaaccattggtgagaccatc
gaagttgtttgtccaacatctggaaaccctacccccctcattacatggttcaaagacaat
gagacccttgtagaagattcaggcattgtactaaaagacgggaaccggaacctaactatc
cgaagggtgaggaaggaagacgggggcctctacacctgccaggcctgcaatgtccttggc
tgtgcaagagcagagacactcttcataatagaaggtgcccaggaaaagaccaacttggaa
gtcattattctcgtcggcactgcagtgatcgccatgttcttctggctacttcttgtcatt
gttctacggaccgttaagcgggccaatgaaggggaactgaagacaggctacttgtccatt
gtcatggatccagatgaactgcccttggatgagcgctgtgaacgcttgccttatgatgcc
agcaagtgggagttccccagggaccggctgaaactaggaaaacctcttggccgtggtgcc
tttggccaagtgattgaggcagatgcctttggaatcgacaagacagcgacttgcaaaaca
gtggctgtcaagatgttgaaagagggagcaacacacagcgagcaccgagccctcatgtcc
gaactcaagatcctcatccacattggccaccatctcaatgtggtgaacctgctgggtgcc
tgcacgaagcccggagggcctctcatggtgattgtagaattctgcaagtttggaaaccta
tcaacttacttacggggcaagagaaatgaattcgtgccctataagagcaaaggggcacgc
ttccgctctgggaaagactatgttggggagctctccgtagacctgaagcggcgcttggac
agcatcaccagcagtcagagctctgccagctcaggttttgtggaggagaaatccctcagt
gacgtagaggaagaagaagcttctgaagaactctacaaggacttcctgaccttggagcat
ctcatctgttacagcttccaagtggctaagggcatggagttcttggcatcaaggaagtgt
atccacagggacctggcagcacgaaacattctcctatcggagaagaacgtggttaagatc
tgtgactttggcttggcccgggacatttataaagacccagattacgtcagaaaaggagat
gcccgactccctttgaagtggatggctccggaaacaatttttgacagagtatacacaatt
cagagtgacgtgtggtcttttggtgttttgctctgggaaatattttccttaggtgcttcc
ccatatcctggggtcaagattgatgaagaattttgtaggagattgaaagaaggaacgaga
atgcgggctcctgactacaccaccccagaaatgtaccaaaccatgctggattgctggcat
gaggaccccaaccagagacccgcgttttcagagttggtggagcacttgggaaatctcctg
caagcaaatgctcagcaggatggcaaagactatattgttcttccaatgtcagagacactg
agcatggaagaggattctggactctccctgcctacctcacctgtttcctgtatggaggaa
gaggaagtgtgcgaccccaaattccattatgacaacacagcaggaatcagtcattatctg
cagaacagcaagcgaaaaagccggccagtgagtgtaaaaacatttgaagatatccctttg
gaggaaccagaagtaaaagtgattccagatgacagccagacagacagtgggatggtcctt
gcctcagaagagctgaaaactctggaagacaggaacaaattatctccatcttttggtggg
atgatgcccagtaaaagcagggagtctgtggcctcggaaggctccaaccagaccagcggc
taccagtctgggtatcactcagacgacacagataccaccgtgtactccagcgacgaggca
ggacttttaaagctggtggatgttgcagggcacgttgactctgggaccacactgcgctca
tctcctgtttaa

DBGET integrated database retrieval system