KEGG   Rattus norvegicus (rat): 25651
Entry
25651             CDS       T01003                                 

Gene name
Selp, PSELECT
Definition
(RefSeq) selectin P
  KO
K06496  selectin, platelet
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno05144  Malaria
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    25651 (Selp)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    25651 (Selp)
  09174 Infectious disease: parasitic
   05144 Malaria
    25651 (Selp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    25651 (Selp)
   04090 CD molecules [BR:rno04090]
    25651 (Selp)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25651 (Selp)
   04091 Lectins [BR:rno04091]
    25651 (Selp)
Cell adhesion molecules [BR:rno04515]
 Selectins
  Selectin family
   25651 (Selp)
CD molecules [BR:rno04090]
 Proteins
  25651 (Selp)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   25651 (Selp)
Lectins [BR:rno04091]
 C-Type lectins
  Group 4: Selectins
   25651 (Selp)
SSDB
Motif
Pfam: Sushi Lectin_C EGF_2
Other DBs
NCBI-GeneID: 25651
NCBI-ProteinID: NP_037246
RGD: 3656
Ensembl: ENSRNOG00000002794
Vega: OTTRNOG00000001152
UniProt: P98106
Position
13q23
AA seq 768 aa
MAGCPKGSWKPRLRSVVLGAAQLIWLSALISELVNRKKVATWTYNYSTKAYSWNNSRAFC
KRHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADN
EPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGERIETIGS
YTCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPS
EMQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRG
SDILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVL
MGNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGPLKYQSACSFSCDEGS
LLVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDE
GFYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSC
NEEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESF
GPNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWG
NFSYGSTCAFHCPEGQSLNGSARTTCGEDGHWSDAMPTCQAGTLTIQEALTYLGGALAST
SGLAVGGTLLALLRKRLRKKDDGKCPLNPHSHLGTYGVFTNAAYDPTP
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggccggctgcccaaaaggttcttggaagccaagactccggagtgtagtcctgggagca
gctcagcttatctggctcagtgctttgatctctgagcttgtaaatcgaaagaaagtggcg
acgtggacctataactacagcacgaaagcatactcatggaataactcacgggcattctgc
aagaggcacttcacagacttagtggccatccagaacaagaatgaaatcgctcacctcaat
gacgtcatcccatacgtcaactcttactactggattggtatccgaaagatcaacaataag
tggacctgggtgggaaccaataagactctcacggcggaggctgagaactgggcagacaac
gagcccaataacaagaggaacaaccaggactgtgtggagatctacatcaagagtaattcg
gcccctggcaagtggaatgatgagccctgctttaaacgaaagcgggccctgtgctacaca
gcctcctgccaggacatgtcttgcaacagccaaggggagcgcatcgagaccattgggagc
tacacctgctcctgctacccgggcttctatgggccagagtgtgaatacgtccaagagtgt
ggaaaattcgacatcccgcaacacgttctcatgaactgcagccaccctctgggggacttc
tccttcagctcacagtgcaccttcagctgtcctgagggctatgacctgaacggacccagt
gagatgcaatgtttggcctctggaatctggacaaataatcccccgcagtgtaaagctgtg
cagtgccagagcctggaagcccctctccatggaaccatggactgtacacacccattggct
gcctttgcctatgactccagctgtaaatttgagtgccagcctggatatcggatgaggggc
tctgacatactccactgcactgactctggtcagtggagtgaaccattgccaacctgtgaa
gccattgcatgcgaaccgctggagagccccctccatgggagcatggactgcttcccatcc
acaggagcattcgggtacaacagcagctgcacttttcgctgcacagagggattcgtgctg
atgggaaatgatgccattcattgtgctgacttggggcagtggacagccccagccccagtc
tgtgaagcgttgcaatgtcaggagtttccggtcccaagtaaagcccaggtgagctgctcg
gaccccttcggacccttgaagtaccagtcagcctgcagcttttcctgtgatgaaggctca
ctcttggtgggagcaagtgtgataagatgcttggctactggacactggagtgaggcccct
cctgaatgtcaagctgtctcctgcacccctttgctcagccctgagaatggaaccatgacg
tgtatccagcctcttgggcattccaactacaaatccacatgccagttcatgtgtgacgaa
ggattttatctatctggaccagaaagattggactgttctccatctggacactggacaggc
agccctccaatgtgtgaagccatcaagtgcccagaaatctttgccccagaacaaggcagc
ttggactgctctcatgttcatggagaattcagtgtcggctccacctgtcacttctcctgc
aacgaggagtttgagctcctgggatctcgaaatgtggagtgcacagtgtctggaagatgg
tcagcgcctccaccaacctgcaaaggtgtaacatcacttcctgtcccatcggttcgatgc
cccgccctcactactcctggacagggcacaatgtcctgtcgacaccacctggaaagcttt
ggtccgaacaccacttgttactttgggtgcaaaacaggatttacactcagaggagccaac
tctctccgctgcggggcttcaggacaatggacagcagtgacgcccgtgtgcagagccgtc
aaatgctcagaattgcacatggacacagcagtcgcgatgaactgttccaacccctgggga
aactttagctacggatcaacctgtgccttccactgtccagaggggcagtcactgaatggc
tctgccaggacaacctgcggagaggacggtcactggtcagatgctatgccaacctgccaa
gcagggacgctgacgatccaggaagctctgacttacttgggtggcgccttggcttctact
tctggcctggcagtgggcgggacgctactggctctgctaagaaagcgtctcagaaagaaa
gatgatggaaaatgccccctgaaccctcacagccacctaggaacatatggagtcttcacg
aacgctgcatatgacccaaccccttaa

DBGET integrated database retrieval system