KEGG   Rattus norvegicus (rat): 25654Help
Entry
25654             CDS       T01003                                 

Gene name
Col11a1
Definition
(RefSeq) collagen type XI alpha 1 chain
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    25654 (Col11a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25654 (Col11a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   25654 (Col11a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_3 Laminin_G_2 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 25654
NCBI-ProteinID: NP_037249
RGD: 2372
Ensembl: ENSRNOG00000023148
UniProt: P20909
Position
2q41
AA seq 1804 aa AA seqDB search
MEPWSRWKTKRWIWDLTISTLVLTFLFQAREVRGAAPVDILKALDFHNSPVGISKTTGFC
TSRKNSKDPDIAYRVTEEAQISAPTKQLFPGGIFPQDFSILFTIKPKKGTQAFLLSLYNE
HGIQQLGVEVGRSPVFLFEDHTGKPTPENYPLFSTVNIADGKWHRVAISVEKKTVTMIVD
CKKKITKPLDRSERSIVDTNGIMVFGTRILETDVFQGDIQQFLITGDPKAAYDYCDHYSP
DCDLTSKAAQAQEPHIDEYAPEDIIEYDYEYGETDYKEAESVTEMPTVTEETVAQTEANI
VDDFQDYNYGTMETYQTESPRRVSGSNEPNPVEEGFTEEYLTGEDYDVQRNISEDILYGN
KGIDGRDSDLLVDGDLGEYDFYEYKEYEERTTTSPNEEFGPGVPAETDFTETSINGHGAY
GEKGQKGEPAVVEPGMLVEGPPGPAGPAGLMGPPGLQGPSGLPGDPGDRGPPGRPGLPGA
DGLPGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGRPGP
VGGPGSAGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGSKGDRGF
DGLPGLPGDKGHRGERGPQGPPGLPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGP
PGQPGIGGIDGPQGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKPGL
AGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEKGE
DGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGL
PGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGSRGARGPTGKPGP
KGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPAGKDGLPGHPGQRGETGFQGKTGP
PGPGGVVGPQGPTGETGPIGERGHPGTPGPPGEQGLPGAAGKEGAKGDPGPQGISGKDGP
AGIRGFPGERGLPGAQGAPGLKGGEGPQGPQGPIGSPGERGSAGTAGPIGLPGRPGPQGP
PGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGD
KGENGPPGPPGLQGPVGAPGIAGGDGEAGPRGQQGMFGQKGDEGARGFPGPPGPIGLQGL
PGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGGVGEKGEPGEAGN
PGPPGEAGSGGPKGERGEKGEAGPPGAAGPPGIKGPPGDDGPKGNPGPVGFPGDPGPPGE
PGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGASGSEGRQGEKGAKGE
AGAEGPPGKTGPVGPQGPSGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPLGPPGLPGL
KGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGIPGPAGPIGPPGP
PGLPGPAGPKGNKGSSGPTGQKGDSGMPGPPGPPGPPGEVIQPLPILSPKKTRRHTESIQ
ADAGDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEY
WIDPNQGCSGDSFKVYCNFTAGGETCIYPDKKSEGVRLSSWPKEKPGSWYSEFKRGKLLS
YLDVEGNSINMVQMTFLKLLTASARQNFTYNCHQSTAWYDVLSGSYDKALRFLGSNDEEM
SYENNPHIKALYDGCASRKGYEKTVIEINTPKIDQVPIIDVMINDFGDQNQKFGFEVGPA
CFLG
NT seq 5415 nt NT seq  +upstreamnt  +downstreamnt
atggagccctggtccaggtggaaaacgaaacggtggatctgggatctcaccatctcaacc
ctcgtcttgacttttctcttccaagccagagaggtcagaggagctgctccagttgatata
ctgaaagcattagattttcacaattctccagtgggaatatctaaaacaacaggattttgc
acaagcagaaagaattctaaagatccagatatcgcttatagagttaccgaggaagcccag
atcagtgccccaacgaagcagttatttccaggaggaatttttccgcaagatttttcaata
ctatttacaataaaacccaaaaaaggaactcaagctttcctcttgtctctctacaatgaa
catggcattcagcaactcggtgttgaggttgggagatcacctgtttttctatttgaagac
cacactggaaaacccacaccagaaaactatcctctcttctcaacagttaacattgctgat
ggaaagtggcaccgggtagcaatcagtgtggagaagaaaactgtgacaatgattgtcgat
tgtaagaagaaaatcacaaaacccctcgatagaagcgagagatcgatagtcgataccaac
ggaatcatggtatttggaacaagaattttagaaacagatgttttccagggtgatattcag
cagttcctgatcactggtgaccccaaggcagcatatgactactgtgaccattacagtccc
gactgtgacttaacatccaaggccgctcaggcccaggagccgcacatagatgagtatgca
cctgaggatataatcgagtatgactatgaatatggggagacagactataaagaggctgag
agtgtaacagagatgcccactgtcactgaagaaacagtagcacaaactgaggcaaatatt
gtggatgactttcaagactataactatggaacgatggaaacttaccagactgagtctcct
cggcgggtatcaggatcaaatgagccaaatccagttgaagaaggttttactgaagaatat
ctaaccggagaggattatgatgtccagagaaacatttccgaggatattctgtatggaaac
aaaggaatagacggcagggattctgatctgctggtagatggagatttaggtgaatatgat
ttttatgaatacaaagaatatgaagaaaggactacgacctcccctaatgaagaatttggc
ccaggtgtcccagcagaaactgatttcacagaaacaagcatcaatggccatggcgcatat
ggagagaaagggcagaagggggaacctgctgtagttgaacccggaatgcttgttgaagga
ccacctgggccagctggaccagcgggtcttatgggtcctccaggactacaaggtccttct
gggctccccggcgaccctggtgataggggcccaccaggacgccctggcttaccaggggct
gatggcttacccggtcctccaggaaccatgttaatgttaccattccgctatgggggtgac
ggctccaaaggaccaaccatctctgcgcaggaagcccaggctcaggcgattcttcagcag
gctcggattgctctgagaggccctcctggcccaatgggtcttaccggaagaccaggtcct
gtggggggtcctggttcagctggagccaaaggtgagagtggggatccaggtcctcagggt
cctcgaggtgtccaaggtcctcctggtccaaccggaaaacctggaaagaggggccgtcca
ggtgccgatggaggaagaggcatgccaggagaacctgggtctaagggagaccgagggttt
gatggacttccaggtctgccaggtgacaaaggtcacaggggggaaagaggtccacaaggt
ccacctggcctccccggcgatgatggaatgaggggagaagatggagagatcgggcccagg
ggtcttccaggggaagctggtccacgaggcttgctgggaccaaggggcactccaggacct
cctgggcagcctggtattggaggtatagatggcccccaaggaccaaaaggaaacatgggt
cctcaaggggagcctggaccaccaggtcagcaaggaaatccaggacctcaaggacttcct
ggtccacaaggcccaattggtcctcctggagaaaaaggaccacaaggaaaaccagggctt
gcaggacttcctggtgccgatggacctcctggtcatcctgggaaagaaggccagtctgga
gaaaagggtgccctgggtcctcctggtcctcagggacctattggctatcccggtccccgt
ggagtaaagggagcagatggtgtcagaggtctcaagggctctaaaggagaaaagggtgaa
gatggctttccaggattcaaaggtgacatgggtcttaaaggtgacagaggcgaagtgggt
caagttggtccaagaggagaagatggccctgaaggccccaaaggccgtgcaggcccaact
ggagacccaggtccctctggccaagcaggagagaagggaaaacttggggttccaggattg
ccaggatatccaggaagacaaggtccaaagggatccactggatttcctggatttccaggt
gccaacggggagaaaggtgcccggggaattgctggcaaaccaggcccccgaggacaacgt
ggtccaacgggtcctcgaggttccagaggcgccagaggtcccacaggaaaacctgggccg
aagggtacatcaggtggtgatggccctcctggcccaccaggcgaaaggggccctcaagga
cctcaaggtccagttggattccctggaccaaaaggcccccctggccctgctgggaaagat
gggctaccaggacaccctggacaacgtggagagactggatttcaaggaaagaccggtccc
cctgggccaggaggtgtggtaggaccacagggaccaactggtgagactggcccgataggt
gaacgtgggcatcctggcactcctggtcctccgggcgagcaaggacttcctggtgctgca
gggaaagaaggtgcaaagggtgatcctggtcctcaaggtatctcagggaaagatggacca
gcaggaatccgtggtttcccaggtgaaagaggccttcctggagcccagggcgcacctggg
ttgaaaggaggagaaggtccccaaggcccgcagggtccaattggctctcctggagagcga
ggctctgcaggcacagcaggcccaattggtttgccaggacgtccaggccctcagggccct
cctggtccagctggagaaaaaggtgctccgggagaaaagggtcctcaggggcctgcaggt
agagatggggtccaaggccctgtgggtctcccagggcctgctggtcctgctggctctcct
ggagaagatggagacaagggtgaaattggtgaaccaggccaaaagggcagcaaaggtgac
aaaggcgaaaatggtcctcctggtcccccgggtcttcaaggccctgttggtgctcctgga
attgctggaggagatggtgaggcaggtccccgaggacagcagggaatgtttggacaaaaa
ggtgatgagggtgcacgaggtttcccaggacctcctgggcccataggtcttcaggggttg
ccaggcccaccaggtgaaaagggcgaaaacggagacgttggccctatgggtccaccaggt
cctcctggcccacgaggccctcaaggtcccaatggagctgatggaccacaaggaccccca
ggctctattggttcagttggtggtgtgggagaaaagggtgaaccaggagaagcagggaac
ccaggaccccctggagaagccggatcaggtggtcccaaaggagagagaggagagaaagga
gaagctgggccccctggtgctgcgggtcctcctggtattaaggggccaccaggtgatgat
ggacccaaggggaatccgggacctgttgggtttcctggagatcctggtccacctggagaa
cctggtcctgcagggcaagatggtgttggaggtgacaagggtgaagatggagatccagga
caaccaggtccccctggtccatccggtgaagctggccctccaggtccacctggaaagaga
ggtccgcctggagcttccggttccgaaggaaggcaaggagagaaaggtgctaagggagaa
gctggagctgaaggacctcctgggaaaactggcccggtcggacctcagggtccttctgga
aagcctggtccagaaggtcttcgaggcatccctggtcctgtgggagaacaaggtctcccc
ggtgctgctggccaagatggaccccctggtcctctgggacctcctggtttacctggtctc
aaaggtgatcctggctccaagggtgaaaagggacatcctggtttaattggattgattggc
cctccaggagaacaaggggaaaagggtgacagaggacttcctgggactcaaggttctcca
ggagccaaaggtgatgggggcatcccaggtcctgctggtcccataggtcctcctggtcct
ccaggattaccaggtcctgctggtccgaagggtaacaaaggatcttctggacctactggc
cagaagggtgacagtggtatgccaggacctcctgggcctccaggtcctcctggagaagtc
atacagccattacctattttgtcaccgaagaaaacaagaagacacactgaaagcatccag
gccgacgcaggtgataatattcttgactactcagatggcatggaggaaatatttggttcc
ctcaattctctgaaacaagacattgaacacatgaagtttcccatgggtacacagaccaac
ccagcacgaacatgcaaagacctgcagctcagccaccccgacttcccagatggtgaatat
tggattgatcctaaccaaggctgctcaggtgattccttcaaagtttactgtaatttcaca
gctggtggtgagacgtgcatctatccagacaaaaaatctgagggagtaagactttcatct
tggccgaaggagaaaccaggaagttggtacagtgaatttaagagaggaaaactgctttcc
tatttagatgtggaaggcaattccatcaatatggtacaaatgacattcctgaaactcctg
actgcctctgccagacaaaacttcacctacaattgccaccagtcaactgcttggtatgac
gtcttatcaggaagttatgacaaagcacttcggtttctgggatctaatgatgaggaaatg
tcctacgagaacaacccacacatcaaagctttgtatgacggctgtgcgtcccgaaaaggc
tatgaaaagacagtgattgagatcaatactccgaaaattgatcaagtacccatcattgat
gtaatgatcaatgattttggtgatcagaatcagaagtttggatttgaagttggtccagct
tgctttcttggctaa

DBGET integrated database retrieval system