KEGG   Rattus norvegicus (rat): 25661
Entry
25661             CDS       T01003                                 

Gene name
Fn1, FIBNEC, fn-1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25661 (Fn1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25661 (Fn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25661 (Fn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25661 (Fn1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25661 (Fn1)
   05205 Proteoglycans in cancer
    25661 (Fn1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    25661 (Fn1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25661 (Fn1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25661 (Fn1)
   05100 Bacterial invasion of epithelial cells
    25661 (Fn1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25661 (Fn1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25661 (Fn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25661 (Fn1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25661 (Fn1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25661 (Fn1)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    25661 (Fn1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   25661 (Fn1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   25661 (Fn1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 Arrestin_N
Other DBs
NCBI-GeneID: 25661
NCBI-ProteinID: NP_062016
RGD: 2624
Ensembl: ENSRNOG00000014288
UniProt: A0A096P6L8
Position
9q33
AA seq 2477 aa
MLRGPGPGRLLLLAVLCLGTSVRCTETGKSKRQAQQIVQPPSPVAVSQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYKVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHVLQSASAGSGSFTDVRTAIYQPQTHP
QPAPYGHCVTDSGVVYSVGMQWLKSQGDKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGNSNGALC
HFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWKEATIP
GHLNSYTIKGLTPGVIYEGQLISIQQYGHQEVTRFDFTTSASTPVTSNTVTGETAPFSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGV
PRSDDVPAPKDLQFVEVTDVKVTIMWTPPNSAVTGYRVDVLPVNLPGEHGQRLPVNRNTF
AEVTGLSPGVTYLFKVFAVHQGRESKPLTAQQTTKLDAPTNLQFVNETDRTVLVTWTPPR
ARIAGYRLTVGLTRGGQPKQYNVGPMASKYPLRNLQPGSEYTVTLMAVKGNQQSPKATGV
FTTLQPLRSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYTYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGTALEEVVHADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISD
TVIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVG
YYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPP
PSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPL
RGRQKTGLDSPTGFDSSDVTANSFTVHWVAPRAPITGYIIRHHAEHSAGRPRQDRVPPSR
NSITLTNLNPGTEYIVTIIAVNGREESPPLIGQQSTVSDVPRDLEVIASTPTSLLISWEP
PAVSVRYYRITYGETGGNSPVQEFTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPAS
SKPVSINYQTEIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTAPKNGLGPTKSQTV
SPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKI
AWESPQGQVSRYRVTYSSPEDGIHELFPAPDGDEDTAELHGLRPGSEYTVSVVALHGGME
SQPLIGVQSTAIPAPTNLKFTQVSPTTLTAQWTAPSVKLTGYRVRVTPKEKTGPMKEINL
SPDSTSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTI
TISWRTKTETITGFQVDAIPANGQTPVQRTISPDVRSYTITGLQPGTDYKIHLYTLNDNA
RSSPVVIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI
LDVPSTVQKTPFVTNPGYDTENGIQLPGTSHQQPSVGQQMIFEEHGFRRTTPPTAATPVR
LRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESS
EYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALHNQRRHKVREEVVTV
GNTVNEGLNQPTDDSCFDPYTVSHYAVGEEWERLSDSGFKLTCQCLGFGSGHFRCDSSKW
CHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYHQRTNTNVNCPI
ECFMPLDVQADRDDSRE
NT seq 7434 nt   +upstreamnt  +downstreamnt
atgctcaggggtccgggacccgggcggctgctgctgctagcagtcctgtgcctggggaca
tcggtgcgctgcaccgaaaccgggaagagcaagaggcaggctcagcaaatcgtgcagcct
ccgtccccggtggctgtcagtcagagcaagcctggctgttttgacaacgggaagcattat
cagataaatcagcagtgggaacggacctacctaggcaacgccctggtttgtacctgctat
ggaggaagcagaggttttaactgcgagagcaagcctgaacctgaagagacctgttttgac
aaatacactggaaacacttacaaagtgggtgacacttatgagcgccctaaagattccatg
atctgggactgtacctgcattggggctgggcgaggcaggatcagctgtaccattgcaaat
cgctgccatgaagggggtcagtcctacaagattggtgacaagtggaggaggccacatgag
actggtggctatatgttggagtgtttgtgtctggggaatggaaaaggggaatggacctgc
aagccaatagctgagaaatgttttgatcacgctgctgggacttcctacgtcgtgggggag
acctgggaaaagccctaccaaggctggatgatggtggactgtacttgtctgggcgaaggc
aatgggcgtatcacctgcacctcccggaacagatgcaatgatcaggacaccaggacgtcc
tacagaattggagacacatggagcaagaaggacaacagagggaacctgctccagtgtgtc
tgcacaggcaacggcagaggggagtggaagtgtgagcgacatgttctacagagtgcttca
gctggatctggctccttcacagatgtccgaacagctatttaccaaccccagacccacccc
cagcccgcaccgtacggccactgtgtcacagacagcggtgtggtctactctgtgggaatg
cagtggctgaagtctcaaggagacaagcagatgctgtgcacttgcctgggcaatggcgtc
agctgccaggagacagctgtgacccagacttacggtggcaactcaaacggggagccctgt
gttctcccgttcacctacaacggtaggaccttctactcctgcaccaccgaagggcggcaa
gacggacatctgtggtgtagcacaacttcaaattatgaacaagaccagaagtattctttc
tgcacagaccacgcggttttggttcagactcgaggtgggaattccaatggtgccttgtgc
cacttccccttcctgtacaacaaccggaattacaccgactgtacttctgagggtaggcgg
gacaacatgaaatggtgcggcaccacccagaactacgatgccgatcagaagtttggattc
tgcccaatggctgcccatgaggagatctgcacgaccaacgaaggggtcatgtatcgcatt
ggggaccagtgggataagcagcatgacctgggccacatgatgaggtgcacgtgtgttggg
aacggccgtggagaatgggcctgcatcccctactcccagctccgagatcagtgcatcgtt
gatgacattacttacaacgtcaacgacacgttccacaagcgtcacgaggagggacatatg
ctgaactgtacctgcttcggtcagggccggggcagatggaaatgtgaccccatcgaccag
tgccaagattcagagacccggacattttaccagattggtgactcctgggagaagtttgtg
catggtgtcagataccagtgttactgttacggccgtggcattggggagtggcactgccag
cctctgcagacctacccaggcacaactggacctgttcaagtaattatcacggagaccccc
agccagcccaattcccaccccatccagtggaatgccccggagccttcacacatcaccaag
tacattctcaggtggagacctaaaacctctacgggtcgctggaaggaagctaccattcca
ggccaccttaactcctataccatcaaaggcctgaccccaggtgtgatctacgagggacag
ctcatcagcatccagcagtacgggcaccaagaagtgactcgctttgacttcaccaccagc
gccagcacacctgtgaccagcaacacagtgactggagagactgcgcccttttctcctgtt
gtggccacttccgaatctgtcactgaaatcacagccagcagcttcgtggtctcctgggtc
tcagcttccgacacggtgtcaggattccgagtggagtacgaactgagcgaggaaggagat
gagcctcagtaccttgatcttccaagcacagccacttctgtgaacattcctgacctgctc
ccgggcagaaagtacatcgtcaacgtctatcagatatctgaagagggaaagcagagcttg
atcctgtctacatcacagactacagcacctgatgcgcctccagaccctactgtggaccag
gttgatgacacttccattgttgttcgatggagcagaccccaggcacctatcacagggtac
aggattgtctattcaccttcagtagaaggcagtagcacagaactcaaccttcctgaaacg
gccaactccgtcaccctcagcgacctgcagcccggtgttcagtacaacatcactatctat
gctgtggaggagaaccaggagagcacacccgttttcatccagcaggagactactggcgtc
ccacgatccgatgatgttcccgctccaaaggacctacagtttgtggaagtgaccgacgtg
aaagtcaccatcatgtggacacctcctaatagcgcagtgactggataccgtgtggatgtc
ctgcctgtcaacctgccaggggaacatgggcagaggctgcctgtcaacaggaacaccttt
gctgaagtcaccggactgtccccaggggtcacgtacctcttcaaagtctttgctgtgcat
cagggcagggaaagcaagcctctgacagcacaacagaccaccaaactcgatgctcccact
aacctccagtttgtcaatgaaacggacagaacagttctggtaacttggactccacctcga
gcccggatagcaggctaccgactgacagtgggcctcacccgaggaggccagcccaagcag
tacaatgtgggacccatggcttccaagtatcccctgagaaatctgcagcctgggtctgag
tacactgtgaccttgatggctgtgaaaggcaaccagcagagtcccaaagccaccggagtc
tttactaccctgcagcctctgcgctccattccaccttataacaccgaggtgacagagacc
acaatcgtgatcacctggacccccgctccaaggattggcttcaagctgggtgtacgacca
agccagggaggtgaagcaccccgagaagtgacttcagactcaggaagcatcgttgtgtct
ggcttgactccaggcgtggaatacacgtacaccatccaagtcctgagggacggccaggag
agagatgcaccaattgtcaaccgagtagtgacaccgctgtctcccccaaccaacttgcac
ctggaggccaatcctgacactggagtgcttaccgtctcctgggagaggagcaccacccca
gatattactggctacagaataaccaccacccccacaaacgggcagcagggaaccgctttg
gaagaagtggttcatgccgatcagagttcctgcacttttgaaaacctgaatcctggcctg
gagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgcccctatctctgat
accgtcatcccagaggtgccccagctcactgacctaagctttgttgatataactgactca
agcatcggcctgaggtggaccccgctaaactcttccaccattatcgggtaccgaatcaca
gtagttgcggcaggagaagggatccccatttttgaagattttgtggactcctcagtagga
tactacacagttacagggctggaacccggcattgactatgacatcagcgttatcactctc
attaatggcggagagagtgcccctactacactgacacagcaaacggccgtccctcctccc
acggatctgcgattcaccaatatcggtccggacactatgcgggtcacttgggccccgcct
ccgtccattgagctaaccaacctcttggtgcgctactcacctgtgaagaacgaggaggat
gtggcagagctgtccatttcaccctcagacaacgccgtggtcctaacaaatctcctgcct
gggactgagtacttagtcagtgtctccagcgtgtacgaacagcatgagagcatccctctc
agaggaagacagaaaacaggtctggactccccaactggttttgattcttctgatgtcacc
gccaactcattcaccgtccactgggtggctcctcgggcccccatcaccggctacatcatc
cgccatcacgccgagcattctgccggaagacccaggcaagaccgagtgccgccctcaagg
aattctatcaccctcaccaaccttaatccgggcacggagtacattgtcaccatcattgct
gttaatggcagagaggagagccccccactgattggccagcaatccacggtttccgatgtc
ccgagagatctggaggtcatcgcttccacccccaccagcctgctcatcagttgggaaccc
cccgccgtctctgtgcgctattacagaatcacctatggagagacaggaggaaatagccct
gtccaggaattcactgtgcccggaagcaagtccaccgccaccatcaacaacattaaacca
ggagcagactacaccatcaccctgtatgctgtcactggccgtggggacagtccagccagc
agcaagccagtttccatcaattatcaaacagaaattgacaagccatcccagatgcaggtg
acggatgtccaggacaacagcatcagtgtcaggtggctgccttcaacttctcctgtgaca
ggttacagagtgaccaccgctcccaaaaatggcctaggaccaacaaaatctcaaactgtc
agtccagatcaaacagaaatgaccattgaaggtttgcaacccaccgtggagtatgtggtt
agtgtctatgctcagaaccggaacggagaaagccagcccctggttcagactgcagtgacc
aacattgaccgccctaaaggactggcattcactgatgtggatgtcgattccatcaaaatt
gcctgggaaagcccacaggggcaagtttccaggtacagggtgacctactcaagccctgag
gatggaatccatgagcttttccctgcgcctgatggtgacgaggacacggcagagctgcac
ggcctcaggccgggttctgagtacacagtcagtgtggttgccttgcacggtggcatggag
agccagcccctgattggagtccagtccacagccattcctgcgccaaccaatctgaagttc
actcaggtgtcacccaccaccttgactgcccagtggacagcacccagtgttaagctcact
ggctaccgagtgcgggtgaccccgaaggagaagacaggaccaatgaaagaaatcaacctt
tctccagacagcacctccgtgattgtgtcagggctcatggtggccaccaagtatgaagtc
agcgtctatgctctcaaggacacattgacaagcagaccagctcagggagtcgtcacgact
ctggagaatgtcagccctccaagaagggcccgtgtgaccgacgctacagaaactaccatc
actattagctggagaacgaagacagagacgatcactggcttccaagtcgatgccattcca
gccaatggccagaccccggttcagaggaccatcagcccggatgtcagaagctatactatt
acaggtttacagccaggcactgactacaagatccacctgtacacgctcaacgacaatgcc
cggagctctcctgtggtcattgatgcctccacggccattgatgccccatccaacctgcgg
ttcctgaccaccacacccaactccttgctggtatcatggcaggcaccccgtgccaggatt
actggctacattatcaagtatgagaagcctggatcccctcccagagaagtggtccctcgg
ccccgccctggtgtcacggaggccaccatcactggtctggagccaggaaccgagtacacc
atctatgtcatcgcactgaagaacaatcagaagagtgagcccctgattgggaggaaaaag
acagatgagcttccccaactggttacccttccacaccccaatcttcatggaccagagatc
ttggatgttccctccacagttcaaaagacccccttcgtcaccaaccctgggtatgacacc
gaaaatggtattcagcttcctggcacatcccaccaacaacccagtgttgggcaacaaatg
atctttgaggaacatggctttaggcgaaccacgccacccactgcggccacccccgtcagg
cttaggccaagaccatacctgccgaatgtagatgaggaggtccaaatcggtcatgttccc
aggggagacgtagactaccacctctatcctcatgttccggggctcaatccaaatgcctct
acaggacaagaagctctctctcagacaaccatctcttggacgccattccaggagagttct
gagtacatcatttcatgccaacctgttggcactgacgaagagcccttacagttccaagtt
cctggaacttctaccagtgcgactctgactggccttaccagaggggtcacctacaacatc
atagtggaggccctgcacaaccagaggaggcacaaggtccgagaagaggttgttactgta
ggcaacactgtcaacgaaggcctgaaccagcctacggatgactcatgctttgacccttac
acggtttcccattacgccgttggagaggaatgggagcggttatctgactctggctttaag
ctcacttgccagtgcttgggctttggcagtggtcatttcagatgcgattcatctaaatgg
tgccatgacaacggtgtcaactacaagatcggagagaagtgggatcgtcagggagaaaat
ggccagcggatgagctgcacatgtctcgggaatggaaagggagaattcaaatgcgatccc
catgaagcaacgtgttatgacgacgggaagacctaccacgtaggagaacagtggcagaaa
gagtatctcggagccatttgctcctgcacgtgtttcgggggccagcggggctggcgctgt
gacaactgccgcagacctggggctgctgaacccagtcccgatggtaccactggccacacc
tacaaccagtatacacagagataccatcagagaacgaacactaatgtaaattgcccaatt
gaatgcttcatgccgttggacgtgcaggctgacagagatgattccagagagtaa

DBGET integrated database retrieval system