KEGG   Rattus norvegicus (rat): 25665
Entry
25665             CDS       T01003                                 

Gene name
Scn5a
Definition
(RefSeq) sodium channel protein type 5 subunit alpha isoform 1
  KO
K04838  voltage-gated sodium channel type V alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25665 (Scn5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25665 (Scn5a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   25665 (Scn5a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel GPHH IQ
Other DBs
NCBI-GeneID: 25665
NCBI-ProteinID: NP_037257
RGD: 3637
Ensembl: ENSRNOG00000015049
UniProt: P15389
Position
8
AA seq 2019 aa
MANLLLPRGTSSFRRFTRESLAAIEKRMAEKQARGGSATSQESREGLQEEEAPRPQLDLQ
ASKKLPDLYGNPPRELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHP
VRRAAVKILVHSLFSMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILAR
GFCLHAFTFLRDPWNWLDFSVIVMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTI
VGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTELNGTNGSVEADGL
VWNSLDVYLNDPANYLLKNGTTDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFA
WAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQ
NQATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSHSSLEMSPLAPVTNHERKSKRR
KRLSSGTEDGGDDRLPKSDSEDGPRALNQLSLTHGLSRTSMRPRSSRGSIFTFRRRDQGS
EADFADDENSTAGESESHRTSLLVPWPLRHPSAQGQPGPGASAPGYVLNGKRNSTVDCNG
VVSLLGAGDAEATSPGSYLLRPMVLDRPPDTTTPSEEPGGPQMLTPQAPCADGFEEPGAR
QRALSAVSVLTSALEELEESHRKCPPCWNRFAQHYLIWECCPLWMSIKQKVKFVVMDPFA
DLTITMCIVLNTLFMALEHYNMTAEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQ
GWNIFDSIIVILSLMELGLSRMGNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGAL
GNLTLVLAIIVFIFAVVGMQLFGKNYSELRHRISDSGLLPRWHMMDFFHAFLIIFRILCG
EWIETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDGEMN
NLQLALARIQRGLRFVKRTTWDFCCGILRRRPKKPAALATHSQLPSCITAPRSPPPPEVE
KVPPARKETRFEEDKRPGQGTPGDSEPVCVPIAVAESDTEDQEEDEENSLGTEEESSKQE
SQVVSGGHEPYQEPRAWSQVSETTSSEAGASTSQADWQQEQKTEPQAPGCGETPEDSYSE
GSTADMTNTADLLEQIPDLGEDVKDPEDCFTEGCVRRCPCCMVDTTQSPGKVWWRLRKTC
YRIVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKW
VAYGFKKYFTNAWCWLDFLIVDVSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFE
GMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIV
NNKSECESFNVTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQP
QWEDNLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAM
KKLGSKKPQKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKVN
ILAKINLLFVAIFTGECIVKMAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKYFFS
PTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMAN
FAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGS
RGNCGSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIW
EKFDPEATQFIEYLALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFT
KRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRRHLLQ
RSVKHASFLFRQQAGGSGLSDEDAPEREGLIAYMMNGNFSRRSAPLSSSSISSTSFPPSY
DSVTRATSDNLPVRASDYSRSEDLADFPPSPDRDRESIV
NT seq 6060 nt   +upstreamnt  +downstreamnt
atggcaaacctcctgttacctcggggcaccagcagcttccgtaggttcacccgggagtca
ctggcggccatcgagaagcgaatggctgaaaagcaagcccgaggaggttcggccacctca
caggagagccgtgagggcctgcaggaggaggaggctccccggccccagctggacctacag
gcctccaaaaagctgccagatctctatggcaacccaccccgagagctcatcggggagccc
ctggaagacctggaccctttctatagtacccagaagaccttcatcgtgctgaataagggc
aaaaccatcttccggttcagtgccaccaatgccttgtatgtcctcagccccttccacccc
gtgcgccgagcggccgtgaagatcctggtacactcgctctttagcatgctcatcatgtgc
accatcctgaccaactgcgtgttcatggcccagcacgaccctccgccttggaccaaatat
gttgagtacaccttcactgccatctacacctttgagtctctggtcaagattctagctcga
ggcttctgcctgcatgcattcaccttccttcgggacccgtggaactggctagacttcagt
gtgatcgtcatggcatacacaactgaatttgtggacctgggcaatgtctcagccttacgc
accttccgagtcctccgggccctgaaaactatatcggtcatttcaggcctgaagaccatc
gtgggagccctaatccagtctgtgaagaaactggccgatgtgatggtcctcactgtcttc
tgcctcagtgtctttgccctcattggcctgcagctcttcatgggcaacctgaggcacaag
tgtgtgcgtaacttcaccgagctcaatggcaccaatggttccgtggaggccgacggccta
gtctggaactccctggacgtctacctcaatgacccagccaattacctgctcaagaatggc
accacggatgtgttactatgtgggaacagctctgatgccgggacatgccctgagggctat
cggtgcctgaaggcaggtgagaacccagaccacggttacaccagcttcgactccttcgcc
tgggccttccttgcactcttccgcctgatgacacaggactgctgggaacgcctataccag
cagaccctgaggtccgcaggaaagatctacatgatcttcttcatgcttgtcatctttctg
ggctccttctacctggtgaacttgatcctggctgtggtggccatggcctacgaggagcaa
aaccaagccaccatcgccgagacggaagagaaggagaagcgcttccaggaggccatggag
atgctcaagaaggaacacgaggctctcaccatcaggggtgtggataccgtgtcccatagc
tctctggagatgtctcctttggccccagtaaccaaccatgagagaaagagcaaaaggagg
aaacgactatcttcggggacagaggatggtggggatgacaggctccccaagtcggactca
gaagatggtcccagagcattgaatcagctcagcctcacccatgggctcagccggacatcc
atgaggccccgctcgagccgagggagcattttcacgttccgaagacgggaccaaggctct
gaggcggacttcgcagatgacgagaacagcactgcgggggagagtgagagccaccgcaca
tcgctgctggtaccctggcccctgcgccatcccagcgcccaaggacagcccggccctgga
gcctcagctcccggttacgttctcaatggcaaaaggaacagcaccgtggactgcaatggg
gtggtttccttgctgggggcaggtgacgcagaggccacctccccagggagctaccttctc
cgccctatggtgctggaccgacccccagacacgaccactccgtcagaggagcccggtggg
ccccagatgctgacacctcaggctccgtgtgcagatggttttgaggagcccggagcacgg
caacgggcactcagcgctgtcagtgtcctcaccagtgccctggaagagttggaggagtcc
catcggaagtgtccaccatgctggaaccgctttgcccagcactacctcatctgggagtgc
tgtccactctggatgtccatcaagcagaaggtgaagtttgtggtcatggacccatttgcc
gacctcactatcaccatgtgcatcgtgctcaatacgctcttcatggctctggagcattac
aacatgacggcagagtttgaggagatgctgcaggtcggaaacctggtcttcacgggaatc
ttcacagcggagatgaccttcaagatcatcgcccttgacccctactactacttccagcag
ggctggaatatcttcgacagcatcatcgtcatcctcagtctcatggagctggggctgtcc
cgcatgggcaacttgtctgtgctacgttccttccgtctgctgcgggtcttcaagctggcc
aagtcctggcccaccctgaacacgctcatcaagatcatcgggaactccgtgggcgccctg
gggaacctgaccctggtgctggccatcatcgtcttcatcttcgccgtggtgggcatgcag
ctcttcggcaagaactactcggagctgaggcaccgcatcagcgactccggcctgctgccc
cgctggcacatgatggactttttccacgccttcctcatcatcttccgcatcctctgtggg
gagtggatcgagaccatgtgggactgcatggaggtgtctgggcagtcgctgtgcttgctg
gtcttcctgctcgtcatggtcattggcaaccttgtggtcctgaatctcttcttggccttg
ctgctcagctccttcagcgcagacaacctcacagcccctgacgaggatggggagatgaac
aacctccagctggccctggctcgcatccagaggggcctgcgctttgtcaagcggaccacc
tgggacttctgctgcgggatcctgcggcggcgacctaagaagcccgcggctcttgccacc
cacagccagctgcccagctgtatcaccgcccccaggtccccaccacccccagaggtggag
aaggtgcccccagcccgcaaggaaacacgattcgaggaggacaagcgacccggccagggc
acccctggggattcggagcctgtgtgtgtgcccatcgccgtggctgagtcagacactgaa
gaccaggaagaggatgaagagaacagccttggcacagaggaagagtccagcaaacaggaa
tcccaagttgtgtctggtggccacgagccctaccaggagcccagggcctggagccaggtg
tcagagaccacgtcctctgaagctggggccagtacatctcaggcagactggcagcaagag
cagaaaacggagccccaggccccggggtgcggtgagacccctgaggacagttactccgag
ggcagcacagctgacatgaccaacaccgccgacctcctggagcaaatcccagaccttggt
gaggacgtcaaggacccagaggactgctttactgaaggctgcgtccgacgctgtccctgc
tgcatggtagacacaacccagtccccagggaaggtctggtggcgattgcgcaagacctgc
taccgcatcgtggagcacagctggttcgagactttcatcatcttcatgatcctgctcagc
agtggagcgctggccttcgaggacatctacctggaggagcggaagaccatcaaggttctg
ctggagtacgcggacaagatgttcacctacgtctttgtgttggagatgctgctcaagtgg
gtggcctacggcttcaagaagtacttcaccaacgcctggtgctggctggacttcctgatt
gtggacgtctcgctggtcagcctcgtggcaaacaccttaggcttcgccgaaatgggtccc
atcaagtcactgaggacactgcgtgcacttcgacccctgagggccttgtcgagatttgag
ggcatgcgggtggtggtcaatgcgctggtgggcgccatcccctccatcatgaacgtcctc
ctcgtctgcctcatcttctggctcatcttcagcatcatgggtgtgaacctcttcgccggg
aagttcggtaggtgcatcaaccagacagaaggggacctgcctctgaactacaccatcgtg
aacaacaagagtgagtgcgagtccttcaacgtgaccggagagttgtactggaccaaggtg
aaggtcaactttgacaacgtgggagccgggtacctggccctcctgcaggtggcgacattt
aaaggctggatggacatcatgtatgcggctgtggactccagagggtatgaggagcagccg
cagtgggaagacaacctctacatgtacatctactttgtcgtcttcatcatcttcggctcc
ttcttcaccctcaacctcttcatcggtgtcatcattgacaacttcaaccagcagaagaaa
aagttagggggccaggatatcttcatgacggaggagcagaagaagtactacaatgccatg
aagaagctgggctccaagaaaccccagaagcccatcccacggcccttgaacaagtaccag
ggtttcatattcgacattgtgaccaagcaggccttcgatgtcaccatcatgttcctcatc
tgtttgaacatggtgaccatgatggtggagacagatgaccagagccctgagaaggtcaac
atcttggccaagatcaacctgctcttcgtggccatcttcacaggcgagtgtattgtcaag
atggctgccctgcgccactattacttcaccaacagctggaacatcttcgactttgtggtg
gtcatcctctccattgttggcactgtcctctccgacatcatccagaagtacttcttctcc
ccgacactcttccgggtcatccgtctggccaggatcggccgcatcctcaggctgatccgc
ggagccaaggggattcgcacgctgctcttcgccctcatgatgtccctgcccgccctcttc
aacatcggcctcctcctcttcctcgtcatgttcatctactccatcttcggcatggccaac
ttcgcttacgtcaagtgggaggccggcatcgatgacatgttcaacttccagaccttcgcc
aacagcatgctgtgcctgttccagatcaccacatcggccggctgggacggcctcctcagc
cccatcctcaacacggggcctccctactgcgaccccaacctgcccaacagcaacggctcc
cgggggaactgtgggagcccggcggtgggcatcctcttcttcaccacctacatcatcatc
tccttcctcatcgtggtcaacatgtacatcgccatcatcctcgagaacttcagcgtggcc
accgaggagagcacagagcccctgagcgaggacgacttcgacatgttctatgagatctgg
gagaagttcgacccggaggccacccagttcattgagtatctggccctgtccgactttgca
gatgccttgtctgagccgctccgcatcgccaaacccaaccagataagcctcatcaacatg
gatctgcccatggtgagcggagaccgtatccactgtatggacatactgttcgctttcacc
aagagggtgctcggcgagtctggggagatggatgccctgaagatccagatggaggagaag
ttcatggcggccaacccttccaagatctcctacgagcccatcaccaccaccctgaggaga
aagcacgaggaggtgtcggccacggtcatccagcgtgccttccggaggcacctgctgcag
cgctcggtgaagcacgcctcctttctcttccgccagcaagcgggcggcagtggcctctcc
gatgaggatgcccctgagcgggagggcctcatcgcctacatgatgaatgggaacttctct
cggcgcagtgctccgctctccagctcctccatctcctccacgtccttccccccgtcctac
gacagcgtcacgagagccaccagtgataacctcccggtgcgtgcgtctgactatagccgc
agcgaagatcttgcagacttccctccatctccagatagggaccgagagtctatcgtgtga

DBGET integrated database retrieval system