KEGG   Rattus norvegicus (rat): 25676
Entry
25676             CDS       T01003                                 

Gene name
Rasa1, GAPX, Rasa
Definition
(RefSeq) RAS p21 protein activator 1
  KO
K04352  Ras GTPase-activating protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25676 (Rasa1)
   04014 Ras signaling pathway
    25676 (Rasa1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    25676 (Rasa1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    25676 (Rasa1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   25676 (Rasa1)
SSDB
Motif
Pfam: SH2 RasGAP PH C2 SH3_1 SH3_9 SH2_2 PH_11 SH3_2
Other DBs
NCBI-GeneID: 25676
NCBI-ProteinID: NP_037267
RGD: 3537
Ensembl: ENSRNOG00000029185
UniProt: P50904
Position
2q11
AA seq 1038 aa
MMAAEAGSEEGGPATAGTGGAAATGSSAYPAACRVKLPAAPPMAVAPCPGLADTDLAAAL
GGGAASGSGFLGTGPVSGVLGGAALTGGAAAGVAGAAAAGPAGDIALTKGTLSLPAETLG
PGGGFPPLPPPPLLPPLGSGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRT
IAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQTNVVNHFRIIAMCGDYYIGGRRFSSL
SDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIV
HNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVG
QVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYRKE
QIVEGYYLKEPVPMQDQGQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKR
WKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFS
EEHYIFYFAGETPEQAEDWMKGLQAFCSLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVK
HFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPD
ILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFKEL
ILQKELHVVYALSHVCGQDRTLLASILLKIFLHEKLESLLLCTLNDREISMEDEATTLFR
ATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLAHLL
SILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNNTMRTRVVSGFVFLRLICPAI
LNPRMFNIISDSPSPIAARTLTLVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIM
FLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGVQQHVLKKLLAI
TELLQQKQNQYTKTNDVR
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgatggcggccgaggcgggcagtgaggaaggcggcccggcgaccgcggggaccggcggc
gccgcggccacgggctccagcgcctacccagcagcgtgccgggtaaagttacccgcggcc
cctccgatggcagtcgccccgtgtcctgggctggcggacaccgacctggctgcggccctc
ggtgggggagccgcgtcggggtccgggttcctggggaccgggccggtgtctggtgtcctg
gggggcgccgcgctgaccggcggtgctgcagctggcgtggcgggtgctgcagccgctgga
cctgccggagacatcgctctcaccaaggggactctctctctgcctgctgagactctcggg
ccgggcggcggattccctcctctgccgcctcctcctctgttgcctcctttgggctccggt
ctggggacagtggatgaaggtgactccttggatggaccagaatacgaggaggaagaggtg
gccataccgctgaccgcacctccaactaaccagtggtatcatggaaaacttgatagaact
atagcagaagaacgcctcaggcaggcagggaaatctggaagctaccttataagagagagt
gatcggaggccagggtcctttgtactttcatttcttagccagacaaatgttgtcaatcat
tttaggattattgctatgtgtggtgattactacattggtggaaggcgtttttcttcactc
tcagacctaataggatattacagtcacgtttcttgtttacttaaaggagaaaaattactc
tacccagttgcaccaccagagccagtagaagatagaagacgtgtacgagccattctgccc
tacacaaaagtaccagacactgatgaaataagtttcttaaagggagatatgttcattgtt
cacaatgagttagaagatggatggatgtgggttacaaacctaagaacagatgagcaaggc
cttattgttgaggacctagtggaagaggtgggccgagaagaagatccacatgaaggcaaa
atatggttccatgggaagatttccaaacaagaagcttataatttattaatgacagttggc
caagtctgcagctttcttgtgaggccctcagataatactcctggagattattccctgtat
tttcggaccaatgaaaatatccagcgatttaaaatttgtccaacacctaacaatcagttc
atgatgggaggccgctattataacagtattggggacatcatagaccactatcggaaagaa
cagattgttgaaggctattatcttaaggaacctgtaccaatgcaggatcaaggacaagta
ctcaatgacactgtggatgggaaggaaatctataatacaattcgtcgtaaaacaaaggat
gcattttataaaaatattgttaaaaaaggttatcttctgaagaagggcaaaggaaaacgt
tggaaaaatttatattttatcttagagggcagtgatgcccaacttatttattttgaaagt
gaaaaacgagctacaaaaccaaaagggctaatagatctcagtgtatgttctgtctacgtt
gtccatgatagtctcttcggcaggccaaactgttttcagatagtcgttcagcactttagt
gaagaacattacatcttttactttgcaggagaaactccagaacaagcagaggattggatg
aaaggcctgcaagcattttgcagtttacggaaaagtagcccagggacatctaataaacgc
cttcgtcaggtcagcagccttgtattacatattgaagaagctcataaactaccagtaaaa
cacttcactaatccatattgtaacatctacttgaatagtgtccaagtagcaaaaactcat
gcaagggaggggcaaaacccagtatggtcagaggagtttgtctttgatgatcttcctcct
gacatcaatagatttgaaatcacacttagtaataaaacaaagaaaagtaaagatccagat
atcttatttatgcgttgccagttgagcaggttacagaaaggacatgccacagatgaatgg
tttctgctaagttctcatataccactaaaaggtattgaaccaggatctctgcgtgttcga
gcacgatactctatggaaaaaatcatgccagaagaagagtacagtgaatttaaagagctt
atactgcagaaggaacttcacgtagtctatgctctatcacacgtatgtggacaagaccga
acactactggccagcatcctactgaaaatatttcttcatgaaaagcttgagtcattgttg
ttatgcacactaaatgacagagagataagtatggaagatgaagccactaccctatttcga
gctacaacacttgcgagtaccttgatggagcagtacatgaaagccacggccacgcagttt
gttcatcatgctttgaaagactccattttaaagataatggaaagcaagcaatcatgtgag
ttaagtccatcaaagttagaaaaaaatgaagatgtgaacactaatttagcacacctattg
agcatactttcagagcttgtggagaaaatattcatggcttcagaaatacttccaccgaca
ctgagatatatttatgggtgtttacagaaatcagttcagcataagtggcctacaaataac
accatgagaacacgagttgttagtggttttgtttttcttcggcttatctgcccagctatc
ctgaatccacggatgtttaatatcatctcagattctccatctcctattgctgcaagaaca
ctgacattagtggctaaatctgtgcagaatttagcaaatcttgtggaatttggagctaag
gagccttatatggaaggtgtcaatccattcatcaaaagtaataaacatcgcatgatcatg
tttttagatgaacttgggaatgtacctgagcttccggacactacagaacattctagaact
gacctgtctcgtgacttagcagcattgcatgagatttgtgtagctcattcagatgaactg
agaacactcagtaatgagcgtggtgtacagcagcatgtactgaaaaagcttctggcaata
acagaactgcttcaacaaaagcaaaaccagtatacaaaaaccaatgatgtcaggtag

DBGET integrated database retrieval system