KEGG   Rattus norvegicus (rat): 25681
Entry
25681             CDS       T01003                                 

Symbol
Col10a1
Name
(RefSeq) collagen alpha-1(X) chain
  KO
K19479  collagen type X alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    25681 (Col10a1)
SSDB
Motif
Pfam: Collagen C1q BclA_C
Other DBs
NCBI-GeneID: 25681
NCBI-ProteinID: XP_001053056
RGD: 2371
Ensembl: ENSRNOG00000051399
UniProt: A0A0G2K7A5
Position
20
AA seq 680 aa
MLPQIPFLLLVSLTLVHGTFYAERYQTPTGVKSALASPRTQYFIPYPIKGKEISVRGEQG
IPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGISATGKPGLPGKPGERGPH
GHKGDIGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGLTGAPGSRGFPGEKGAPGAPG
VNGQKGETGYGTPGRPGERGLPGPQGPVGPPGSPGVGRRGENGFPGQPGIKGDRGFPGEA
GPPGPPGPQGPPGKQGREGIGKPGATGSPGRPGIPGEKGHPGAPGIAGPPGAPGFGKQGL
PGLRGQRGPAGLPGAPGAKGEQGPAGHPGEPGLTGSPGNMGPQGPKGIPGNHGIPGTKGE
TGLVGPAGPPGARGARGPPGLDGKTGYPGDPGLNGPKGNPGLPGPKGDPGVGGAPGLRGL
VGPTGPKGVPGHNGEAGPRGEPGIPGTRGPIGPPGIPGFPGSKGDPGKPGAPGPAGIVTK
GLNGPAGPPGRPGPRGHTGEPGLPGPPGPPGPPGPPSQAVIPDGFTKSGQRPRLSGMPLV
SANQGVTGMPVSAFTVILSKAYPAVGAPIPFDEILYNRQQHYDPRSGIFTCKIPGIYYFS
YHIHVKGTHVWVGLYKNGTPTMYTYDEYSKGYLDQASGSAIMELTENDQVWLQLPNAESN
GLYSSEYVHSSFSGFLVAPI
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgctgccacaaataccctttctgctgctagtgtccttgacgctggttcatggaacgttt
tatgctgagcggtaccaaactcccacaggtgtgaagagcgcacttgccagccccaggaca
caatacttcatcccataccctataaagggtaaagagatttcagtaagaggagaacaaggc
attcctggtccaccaggcccagctggacctcgaggacacccaggtccctcaggacctcca
ggaaagccaggctatggaagtcctggactccaaggagagccagggttgccaggaccacca
ggaatatcagccactgggaagccgggcctgccaggcaaaccaggggagagaggaccacat
ggacacaaaggagatattggcccagctggcttaccagggcctcggggccctccaggccca
cccggaatccctggtccagctggaatttctgtgccaggaaaacccggacagcagggactt
acaggtgctccaggatctaggggctttcctggagaaaagggggcaccaggagctcctggt
gtgaatggacagaaaggggaaaccggatatggcactcctggccgtccaggtgagaggggt
cttccaggccctcagggtcctgtaggcccccctggctcccctggagtgggaagaagaggt
gaaaatggctttccgggacagcctggcataaaaggtgaccggggtttcccaggagaagcg
ggaccacccggtccaccaggtccacaaggtcctcctgggaagcaaggacgagaaggtatt
gggaagccaggagccactggatcccccggtcggccaggtatcccaggagaaaaaggccac
ccaggggctccaggaatagctgggcctccaggagctcctggctttggaaaacaaggcttg
ccaggtttgaggggacaaaggggacctgctggtcttcctggggctccaggtgccaaaggg
gaacaagggccagcaggtcatcctggtgaaccaggtctgactggatcccctgggaatatg
ggaccccaaggacctaaaggaatcccagggaatcatggtatcccaggcactaaaggtgag
acaggtctggtggggcctgcagggccacccggggctagaggagcaaggggcccccctggg
ttagatggaaaaacaggatatcctggggatccaggtctcaatggtcctaagggtaaccca
gggttaccaggaccaaaaggtgatcctggagtgggaggagcccctggtcttcgaggtctt
gttggccctacaggacctaaaggagtgcctggacacaatggtgaggcaggtccaagaggt
gaacctggaataccaggtaccaggggccctattggaccaccaggtatcccaggattccct
ggatctaagggtgacccaggaaagccaggtgctccgggcccagctggaatagtaactaag
ggcctcaatgggcccgctggtcctccagggcgtcctggtccaagaggtcatactggagag
cctggtctcccaggtcctccaggacccccaggacctccaggacctcccagccaagcagtc
atacctgatggcttcacaaagagcggacagagacccaggctttctgggatgcctcttgtc
agtgctaaccagggggtaacaggcatgccggtgtccgcttttactgtgattctttccaaa
gcttacccagcggtaggtgctcccatcccatttgatgagattctgtacaacaggcagcag
cactatgacccaagatctggaatctttacctgtaagatcccaggcatatactatttttcc
tatcacatccatgtgaaggggactcacgtttgggtaggcctgtataagaatggcacgccc
acaatgtacacgtatgatgagtacagcaaaggctacttggatcaggcttcagggagcgcg
atcatggagctcacggaaaatgaccaggtgtggctccagttgcccaatgcggaatcgaac
ggcctctactcctctgagtatgtccactcgtccttctcaggattcctagtggctcccata
tga

DBGET integrated database retrieval system