KEGG   Rattus norvegicus (rat): 25690Help
Entry
25690             CDS       T01003                                 

Gene name
Ahr
Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    25690 (Ahr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25690 (Ahr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25690 (Ahr)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    25690 (Ahr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4 PAS_9
Motif
Other DBs
NCBI-GeneID: 25690
NCBI-ProteinID: NP_001295183
RGD: 2074
Ensembl: ENSRNOG00000004342
Position
6q16
AA seq 815 aa AA seqDB search
MSSGANITYASRKRRKPVQKTVKPVPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVI
SKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRSRGQDQCRAQVRDWQDLQEGEFLLQAL
NGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQ
CTDSAQGVDETHGLPQPAVYYTPDQLPPENTAFMERCFRCRLRCLLDNSSGFLAMNFQGR
LKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDA
KGQLILGYTEVELCNKGSGYQFIHAADMLHCAESHIRMIKTGESGMTVFRLLAKHSRWRW
VQSNARLIYRNGRPDYIIATQRPLTDEEGREHLQKRSMTLPFMFATGKAVLYEISSPFSP
IMDPLPIRTKSNTSRKDWAPQSTPSKDSFHPNSLMSALIQQDESIYLCPPSSPAPLDSHF
LMDSMSECGSWQGSFAAASNEALLKHEEIRHTQDVNLTLSGGPSELFPDNKNNDLYSIMR
NLGIDFEDIRSMQNEEFFRTDSSGEVDFKDIDITDEILTYVQDSLNNSTLLNSACQQQPV
SQHLSCMLQERLQLEQQQQLQQQHPTQTLEPQRQLCQVEVPQHELGQKTKHMQVNGMFAS
WNPAPPVSFSCPQQERKHYSLFSGLQGTAQEFPYKSEVDSMPYTQNFAPCNQSLLPEHSK
GTQLDFPGRDFERSLHPNASNLEDFVSCLQVPENQRHGINSQSAMVSPQAYYAGAMSMYQ
CQAGPQHTPVDQMQYSPEIPGSQAFLSKVRAFYRE
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggcgccaacatcacctatgccagccgcaagcggcgcaagccggtgcagaaa
acagtaaagcccgtccctgctgaaggaattaagtcgaacccttctaaacgacacagagac
cggctgaacacagagttagaccgcctggctagcctgctgcccttcccacaagatgttatt
agtaagctggacaaactctccgttctaaggctcagcgtcagctacctgagggccaagagc
ttctttgatgttgcattaaaatccaccccggctgacagaagtagaggccaggaccagtgt
agagcacaagtcagagactggcaggacttgcaagaaggagagttcttgttacaggcgctg
aatggctttgttctggttgtcacggcagatgccttggtcttctatgcgtcttccactatc
caagattacctgggctttcagcaatctgatgtcatacatcagagcgtgtatgagcttatc
catacagaagaccgagctgagttccagcgccagcttcactgggctctaaacccctcacag
tgcacagactctgcacaaggagtagacgagactcatggcctcccacagccagcggtctac
tacacgccagaccagcttcctccagagaataccgctttcatggagaggtgcttcagatgc
cggctgaggtgcctgctggataattcatctggtttcctggcaatgaatttccaagggagg
ttaaagtatcttcatggacagaacaagaaagggaaagacggagcgctactccctccacag
ttggctttgtttgcaatagctactccacttcagccaccgtccatcctggaaattcgaacc
aaaaacttcatcttcaggaccaaacacaaactggacttcacacctattggctgtgatgcc
aaagggcagcttattctgggctacacagaagtagagctgtgcaacaaaggatcgggatat
cagtttatccacgccgctgacatgcttcactgcgcagaatcccacatccgcatgattaag
actggagaaagtggcatgacagttttccggcttcttgcaaaacacagtcgatggaggtgg
gtccagtccaatgcacgcttgatttacagaaatggaagaccagattacatcatcgcaact
cagagaccgctaacggatgaagaaggacgcgaacatttacagaagagaagtatgacactg
ccattcatgtttgccactggaaaggctgtactgtacgagatctccagccctttctctccc
ataatggatcccttgccaatacgcaccaaaagcaacactagtaggaaagactgggctccc
cagtcaaccccgagtaaggattctttccaccccaattcccttatgagtgccttgatccaa
caggacgagtccatctatctctgtcctccttcgagccccgcaccattagacagccatttt
ctcatggactccatgagtgagtgcggcagttggcaaggcagctttgcagccgcaagcaat
gaagctctgctgaaacacgaggaaatcagacacactcaggacgtgaaccttacactctct
ggaggcccctcggagctcttcccagataataaaaataatgacttgtatagcatcatgaga
aacctagggatcgatttcgaagacatcagaagcatgcagaatgaggagttcttccgaacc
gactcctccggtgaggttgacttcaaagacatcgacataacagacgaaatcctgacgtac
gtgcaggattctctgaacaattcaactctgctgaattcagcttgccagcaacagcctgtg
agccagcacctaagctgcatgctgcaggagcgcctgcagctggagcaacaacagcagctt
cagcagcagcaccccactcagacactggagccccagcgccagttgtgtcaggtggaggtc
ccccagcacgagctgggtcagaaaacgaagcacatgcaagtcaatggcatgttcgccagt
tggaaccctgcccctcccgtgtctttcagctgtcctcagcaggaacgaaagcactatagc
ctcttctccggcttacaggggactgcacaggagtttccctacaagtcagaggtggacagt
atgccttacacacagaactttgctccctgcaaccagtcactgctaccagaacattccaag
ggtacacagttggacttccctggaagggattttgaacgatccctgcaccctaacgcttct
aatttagaagactttgtcagttgtttacaagttcctgaaaaccaaagacacgggataaac
tcacagtcagccatggtcagtcctcaggcgtactacgctggggccatgtccatgtaccag
tgccaggcagggcctcagcacacccctgtggaccagatgcagtacagccctgagattcca
ggctcccaggcgttcctaagcaaggtaagggctttctacagggaataa

DBGET integrated database retrieval system