KEGG   Rattus norvegicus (rat): 25705
Entry
25705             CDS       T01003                                 

Gene name
Zeb1, Tcf8, Zfhx1a, deltaEF1
Definition
(RefSeq) zinc finger E-box binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
rno05206  MicroRNAs in cancer
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    25705 (Zeb1)
   05206 MicroRNAs in cancer
    25705 (Zeb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    25705 (Zeb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25705 (Zeb1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    25705 (Zeb1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-Di19 zf-met Homeodomain zf-C2H2_6 zf-C2HE
Other DBs
NCBI-GeneID: 25705
NCBI-ProteinID: NP_001295194
RGD: 3831
Ensembl: ENSRNOG00000017863
UniProt: Q62947
Position
17q12.1
AA seq 1109 aa
MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEESVTDAADCEGGVPDD
ELPTDQTVLPGGSDRAGSAKNCWQDDVKDDECDSDAENEQNHDPNVEEFLQQQDTAVIYP
EAPEEDQRQGTPEASGHDDNGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNF
SCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLR
IHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGRPRSGLKTSQCSSPSLSTSP
GSPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGGGQ
LQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNIIRQVLENNQASLASKE
QEAVSASSIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPGQLQVVPQNLKKENPAPP
KSCKSEKSPEDLTVKSEKDKSFDGAADESTCLLCEDCPGDLNALPELKHYDPEHPAQPPP
PAPATEKPESSASSAGNGDLSPSQPPLKNLLSLLKAYYALNAQPSTEELTKIADSVNLPL
DVVKKWFEKMQAGQIPGQSLEPPSPGPGSGNIPAKTEEQPQPVDGNEPQEDSTRGQSPLK
MTSSPVLPVGSAINGSRSCTSSPSPLNLSSARNPQGYSCVSEGTQEEPQVEPLDLSLPKQ
QGELLERSTVSSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVVPPSANPINI
AIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSATVSPAMQEPPVKVIQ
PNGNQDERQDTSSEGVSVEDQNDSDCTPPKKKTRKAENGMYACDLCDKIFQKSSSLLRHK
YEHTGKRPHECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRY
SYCKRGAEDRDAMEQEDTGPEALPEVLPTELVGARASPSQADSDERESLTREEDEDSEKE
EEEEDKEMEELQEDKECENPQEEEEEEEEEEEEEEEEEEEEAEEAEHEAAAAKTGGAVEE
EAAQQAGSFQQKASGSESKRLSEEKTNEA
NT seq 3330 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaagcaaattcagattcggatgatgaagacaaactccat
attgtggaagaagaaagtgtcacagatgcagctgactgtgaaggtggtgtgccagatgat
gagctgccaacagaccagacagtgttaccaggaggcagtgacagggcgggcagtgccaag
aactgctggcaagacgacgtaaaagatgacgaatgcgactcagatgcagaaaacgagcaa
aaccatgatcccaacgtggaagagttcctgcagcaacaggacaccgcggtcatctaccct
gaggcacccgaggaggaccagcggcagggcacgccagaagccagcggtcatgatgacaat
ggaacaccagatgcattttcccagttgctcacctgcccgtattgtgatagaggctacaag
cgctttacctctttgaaagaacacattaagtaccgccatgagaagaatgaagacaacttc
agctgctccctgtgcagttacacctttgcatacagaacccagcttgaacgtcatatgaca
tcacataagtcaggaagagagcaaagacatgtgacacagtctggaggtaaccgtaagttc
aagtgcaccgagtgtgggaaagcgttcaagtacaaacaccatctgaaggagcacttacgg
atccacagtggagagaagccatatgaatgcccaaactgcaagaaacgtttttcccattct
ggctcttatagctcacacataagcagtaagaagtgtattagcttgatgcctgtgaatggt
aggcccagatcaggactcaagacatctcagtgttcctcgccatctctttcaacatcacca
ggcagtcccacacgcccacagatacggcagaagatagagaataaaccccttcaagaaccg
ctttctgtaaaccaaatcaaaactgaacctgtggattatgagttcaaacccatagtggtt
gcttcaggaatcaactgttcaacccctttacaaaatggggtttttagcggtggtggccaa
ttgcaggcaaccagttctcctcagggtgtggtgcaagctgttgttctgccaacagttggt
ttggtatctcccataagtatcaacttaagtgacattcagaatgtacttaaagtggctgta
gatggtaacataatacgacaggttttggagaataatcaagccagtcttgcatccaaagag
caagaagccgtgagtgcttcatccatccagcagggcggccattctgtcatttctgccatc
agtcttcctttagttgatcaggatggcacaaccaaaatcatcatcaactacagtcttgag
cagcccggccaacttcaggttgttccccagaatctaaagaaagaaaacccagcccctcca
aagagctgcaaaagtgagaagtcaccagaagatcttactgtcaagtcagagaaggacaaa
agctttgatggggctgcggatgagagcacttgccttttgtgtgaggactgcccaggagac
ctcaatgcacttccagaactaaagcactatgacccagagcaccctgctcaacctccaccc
cctgccccagccaccgagaagccagagtcctctgcttcatcagccggcaatggagatttg
tctcccagtcagccacctttaaagaaccttctgtcgctcttaaaagcctactatgctctg
aatgcacagccaagcacagaagagctcaccaagattgccgattctgtgaacctgccgctg
gatgtagttaaaaagtggtttgaaaagatgcaagctggacagattcccgggcagtctctt
gaaccaccttctccaggaccggggtcaggaaacatccctgcaaaaactgaggagcagcct
caacctgtggatggaaatgagccccaggaagacagcacacgtggacagagtcctctcaag
atgacaagctctccagttttaccagtaggatcagccattaacggttccagaagttgcaca
tcatccccatcccctctaaacctttcctcagccaggaacccgcagggttactcttgtgtg
tcagagggtacccaggaggagccccaagtagaacctcttgatctctcactaccaaagcaa
cagggagagttactggaaaggtcgacagtcagtagcgtttaccagaacagtgtttattct
gtccaggaagaacccttgaacttgtcttgtgcaaaaaaggagccacaaaaggacagttgt
gttacagactcagaaccagttgtaaatgtagtcccaccaagtgccaaccccataaacatt
gctattcctacagtcactgcccagttacccacaatcgtggccatcgctgaccagaacagt
gttccgtgcttacgggcactcgctgccaacaagcagactattctgattccccaagtggca
tatacatactccgctacagtcagcccagccatgcaggagccaccagtgaaggtgatccag
ccaaatggaaaccaggatgaaagacaagacactagctcagaaggagtctccgtggaggac
cagaatgactctgactgcacgccacccaaaaagaaaactcggaaggcagagaatgggatg
tacgcatgtgacctgtgtgacaagatatttcagaagagcagctccctgctgagacacaaa
tatgagcatacaggtaagaggccccacgagtgcggaatctgtagaaaggcatttaaacac
aagcatcatttgattgagcacatgcgactgcactctggggaaaagccctaccaatgtgac
aagtgtggcaagcgcttctcacactcggggtcttactctcaacacatgaatcaccgctac
tcctactgcaagagaggagctgaagacagagatgccatggagcaggaagacactgggccg
gaagccctgccggaagtcctgcccactgagcttgttggtgcccgggcatctccctcacag
gctgactcggacgagagagaaagtttgacaagggaagaggatgaagacagtgaaaaggag
gaggaggaggaggataaagagatggaagaattgcaggaagacaaggaatgtgagaaccca
caggaggaggaggaggaggaagaggaggaagaagaagaagaggaggaggaagaggaagag
gaggcagaggaagctgagcatgaggcggcagcagccaagactgggggtgcagtggaggag
gaagcggctcagcaggcaggcagcttccagcagaaggccagcgggagcgagagcaagcga
ctgtctgaagagaagacaaatgaagcctag

DBGET integrated database retrieval system