KEGG   Rattus norvegicus (rat): 25716Help
Entry
25716             CDS       T01003                                 

Gene name
Syt1, P65
Definition
(RefSeq) synaptotagmin 1
  KO
K15290  synaptotagmin-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    25716 (Syt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25716 (Syt1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    25716 (Syt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 CEP76-C2 Comm MAP17 Shisa LYRIC EphA2_TM DUF1258 Herpes_gE RCR
Motif
Other DBs
NCBI-GeneID: 25716
NCBI-ProteinID: NP_001028852
RGD: 3803
Ensembl: ENSRNOG00000006426
UniProt: P21707 Q707P0
Structure
PDB: 

Position
7q21
AA seq 421 aa AA seqDB search
MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWAL
IAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKD
DDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPY
VKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDII
GEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLK
KMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVT
VLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVK
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgccagtcatcctgaggccctggccgcccctgtcaccactgttgcgaccctt
gtcccacacaatgccactgagccagccagtcctggggaagggaaggaagatgccttttcc
aagctgaagcagaagtttatgaatgagctgcataaaattccattgccaccgtgggcctta
atagccatagccatagttgcggtccttttagtcgtaacctgctgcttttgtgtctgtaag
aaatgtttgttcaaaaagaaaaacaagaagaaggggaaggaaaagggaggaaagaacgcc
attaacatgaaagacgtgaaagacttagggaagaccatgaaggatcaggcccttaaggat
gacgatgctgaaaccggactgactgatggagaagaaaaggaagagcccaaggaagaggag
aaactgggaaagctccaatattcactggactatgacttccagaataaccagctgttggtg
ggaatcatccaggctgctgaactgcccgccctggacatggggggtacatccgatccatac
gtcaaagtcttcctgctgcctgacaaaaagaagaaatttgagactaaagtccaccggaaa
accctcaatccagtcttcaatgaacaatttactttcaaggtgccctactcggaattaggt
ggcaaaaccctggtgatggctgtgtatgactttgatcgcttctccaagcatgacatcatc
ggagagttcaaagttcctatgaacaccgtggattttggccatgtgaccgaggagtggcgt
gatctccagagcgctgagaaagaagagcaagagaaactgggtgacatctgcttctccctc
cgctacgtccctactgccggcaaactgactgttgtcattctggaagccaagaacctgaag
aagatggatgtgggtggcttatctgatccctacgtgaagattcacctgatgcagaacggt
aagaggctgaagaagaaaaagacgacgattaagaagaacacactcaacccctactacaac
gagtccttcagctttgaagttccgttcgagcaaatccagaaagtgcaagtggtggtaact
gttttggactatgacaagattggcaagaacgacgccatcggcaaagtcttcgttggttac
aacagcactggggcggagctgcgacactggtcagacatgctggccaacccccggcgaccc
atcgcacagtggcacactctgcaggtagaggaggaggttgatgccatgctggctgtcaag
aagtaa

DBGET integrated database retrieval system