KEGG   Rattus norvegicus (rat): 25718Help
Entry
25718             CDS       T01003                                 

Gene name
Igf1r, IGF-1_receptor, IGFIRC, Igfr1, JTK13
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04144  Endocytosis
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04510  Focal adhesion
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04730  Long-term depression
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25718 (Igf1r)
   04015 Rap1 signaling pathway
    25718 (Igf1r)
   04010 MAPK signaling pathway
    25718 (Igf1r)
   04066 HIF-1 signaling pathway
    25718 (Igf1r)
   04068 FoxO signaling pathway
    25718 (Igf1r)
   04151 PI3K-Akt signaling pathway
    25718 (Igf1r)
   04152 AMPK signaling pathway
    25718 (Igf1r)
   04150 mTOR signaling pathway
    25718 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25718 (Igf1r)
   04140 Autophagy - animal
    25718 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    25718 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25718 (Igf1r)
   04520 Adherens junction
    25718 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    25718 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25718 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    25718 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    25718 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    25718 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    25718 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25718 (Igf1r)
   05202 Transcriptional misregulation in cancer
    25718 (Igf1r)
   05205 Proteoglycans in cancer
    25718 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    25718 (Igf1r)
   05214 Glioma
    25718 (Igf1r)
   05218 Melanoma
    25718 (Igf1r)
   05215 Prostate cancer
    25718 (Igf1r)
   05224 Breast cancer
    25718 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25718 (Igf1r)
   01522 Endocrine resistance
    25718 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25718 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25718 (Igf1r)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25718 (Igf1r)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   25718 (Igf1r)
CD molecules [BR:rno04090]
 Proteins
  25718 (Igf1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 25718
NCBI-ProteinID: NP_434694
RGD: 2869
Ensembl: ENSRNOG00000014187
UniProt: P24062
Position
1q22
AA seq 1370 aa AA seqDB search
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
GECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLFR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERRRRDVLQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEVENNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMELELEPENMESVPLDPSASSASLP
LPERHSGHKAENGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatttgtgggcccggcattgacatccgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgaagctaccgcttccccaagctcacggtc
atcaccgagtacttgctgctgtttcgagtggccggcctcgagagcctgggagacctcttc
ccgaacctcacagtcatccgtggctggaaactcttctacaattacgcactggtcatcttc
gagatgaccaatctcaaggatattgggctttataatctgaggaacattactcggggggcc
atcaggattgagaaaaacgctgacctctgttacctctccaccatagactggtctctcatc
ttggatgcggtgtccaataactacattgtggggaacaagcccccaaaggaatgtggggac
ctgtgtccagggaccttggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgctgccagaaaatgtgcccaagtgtgtgtggg
aagcgagcctgcaccgagaacaatgagtgctgccacccggagtgcctaggcagctgccac
acaccggacgacaacacaacctgcgtggcctgccgacactactactacaaaggcgtgtgc
gtgcctgcctgcccgcctggcacctacaggttcgagggctggcgctgtgtggaccgggat
ttctgcgccaacatccccaacgccgagagcagtgactcagatggcttcgtcatccacgat
ggcgagtgcatgcaggagtgtccatcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgtgaaggcccctgccccaaggtctgcggcgatgaagaaaagaaaacgaaa
accatcgattctgtgacgtctgcccagatgctccaagggtgcaccattttgaagggcaat
ctgcttattaacatccggcgaggcaataacattgcctcggaattggagaacttcatgggg
ctcatcgaggtggtgactggctacgtgaagatccgccattcccatgccttggtctccttg
tccttcctgaagaaccttcgtctcatcttaggagaggagcagctagaagggaactactcc
ttctatgtcctggacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtcagggaaaatgtacttcgctttcaatcccaagctgtgtgtctctgaaatt
taccggatggaggaggtgacaggaacaaagggacggcagagcaaaggagacataaacacc
aggaacaacggagagcgagcttcctgtgaaagtgatgttctccgtttcacctccaccacc
acctggaagaaccgcatcatcataacgtggcaccggtaccggccgccggactaccgggat
ctcatcagtttcacagtctactacaaggaggcaccctttaaaaacgtcacggaatacgac
gggcaggatgcctgtggctccaacagctggaacatggtggacgtggacctgcctccgaac
aaggagggggagcctggcattttgctgcatgggctgaagccctggacccagtatgcagtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccacatccgtggggccaaaagt
gaaatcttgtacattcgcaccaacgcttcagttccttccattcctctagatgtcctctcg
gcatcaaactcctcctctcagctgatcgtgaagtggaaccccccaactctgcccaatggt
aacttgagttactacattgtgaggtggcagcggcagccgcaggatggctatctgttccgg
cacaactactgctccaaagacaaaatacccatcagaaagtacgccgatggtaccatcgat
gtggaggaggtgacagaaaatcccaagacagaagtgtgcggtggtgataaagggccgtgc
tgtgcctgtcctaaaaccgaagctgagaagcaggctgagaaggaggaggctgagtaccgt
aaagtctttgagaatttccttcacaactccatctttgtgcccagacctgagaggaggcgg
agagatgtcctgcaggtggctaacaccaccatgtccagccgaagcaggaacaccacggta
gctgacacctacaatatcacagacccggaagagttcgagacagaataccctttctttgag
agcagagtggataacaaggagaggactgtcatttccaacctccggcctttcactctgtac
cgtatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaac
tttgtctttgcaagaaccatgccagcagaaggagcagatgacattcctggcccagtgacc
tgggagccaagacctgaaaactccatctttttaaagtggccagaacccgagaaccccaac
ggattgattctaatgtatgaaataaaatacggatcgcaagtcgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtatggaggggccaaacttaaccgtctaaacccaggg
aactatacggcccggattcaggctacctccctctctgggaatgggtcgtggacagatcct
gtgttcttctatgtcccagccaaaacaacgtatgagaatttcatgcatctgatcattgct
ctgccggttgccatcctgctgattgtggggggcctggtaatcatgctgtatgtcttccat
agaaagaggaataacagcagattgggcaacggggtgctgtacgcctctgtgaaccccgag
tatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgggagaagatc
accatgaaccgggagctcggacaagggtccttcgggatggtctatgaaggagtggccaag
ggcgtggtcaaggacgagcctgaaaccagagtggccatcaagacagtgaatgaggctgca
agtatgcgtgagagaattgagtttctcaacgaggcctcagtgatgaaggagttcaactgt
caccatgtggtccggttgctgggtgtagtatcccaaggccagcccaccctggtcatcatg
gaactaatgacacgtggcgatctcaaaagttatctccggtctctaaggccagaggtggag
aataatctagtcctgattcctccgagcttaagcaagatgatccagatggctggagagatt
gcagatggcatggcctacctcaatgccaacaagttcgtccacagagacctggctgctcgg
aactgcatggtagctgaagatttcacagtcaaaattggagattttggtatgacacgagac
atctacgagacggactactaccggaaaggcgggaagggcttgctgcctgtgcgctggatg
tctcccgagtccctcaaggatggcgtcttcaccactcattccgatgtctggtcctttggg
gtcgtcctctgggagatcgccactctggctgagcagccgtaccagggcctgtccaacgag
caagttcttcgtttcgtcatggagggcggccttctggacaagccggataactgccccgat
atgctgtttgaacttatgcgcatgtgctggcagtacaaccccaagatgcggccctccttc
ctggagatcatcggaagcatcaaggatgagatggagcccagtttccaggaggtctccttc
tactacagcgaggagaacaagcctccagagccggaggagctggagatggagctggagctg
gagcccgagaacatggagagcgtcccgctggacccttcggcctcctcagcctccctgcct
ctgcctgaaagacactcaggacacaaggctgagaacggccctggcgtgctggttctccgt
gccagttttgatgagagacagccttacgctcacatgaatgggggacgcgccaacgagagg
gccttgcctctgccccagtcctcaacctgctga

DBGET integrated database retrieval system