KEGG   Rattus norvegicus (rat): 25722
Entry
25722             CDS       T01003                                 

Gene name
Scn4a
Definition
(RefSeq) sodium channel protein type 4 subunit alpha
  KO
K04837  voltage-gated sodium channel type IV alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25722 (Scn4a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   25722 (Scn4a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc PKD_channel GPHH IQ Lustrin_cystein
Other DBs
NCBI-GeneID: 25722
NCBI-ProteinID: NP_037310
RGD: 3636
Ensembl: ENSRNOG00000012134
UniProt: P15390
Structure
PDB: 
6MUE 5JR0

Position
10
AA seq 1840 aa
MASSSLPNLVPPGPHCLRPFTPESLAAIEQRAVEEEARLQRNKQMEIEEPERKPRSDLEA
GKNLPLIYGDPPPEVIGIPLEDLDPYYSDKKTFIVLNKGKAIFRFSATPALYLLSPFSIV
RRVAIKVLIHALFSMFIMITILTNCVFMTMSNPPSWSKHVEYTFTGIYTFESLIKMLARG
FCIDDFTFLRDPWNWLDFSVITMAYVTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPMNDTNTTWYGNDTW
YSNDTWYGNDTWYINDTWNSQESWAGNSTFDWEAYINDEGNFYFLEGSNDALLCGNSSDA
GHCPEGYECIKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIF
FVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDQEKEEEFQQMLEKYKKHQEEVEKAK
AAQALESGEEADGDPTHNKDCNGSLDASGEKGPPRPSCSADSAISDAMEELEEAHQKCPP
WWYKCAHKVLIWNCCAPWVKFKHIIYLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHF
DNVLSVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSFIVTLSLVELGLANVQGLS
VLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY
KECVCKIASDCNLPRWHMNDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVM
VIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIGFAKTFLLGLLRG
KILSPKEIILSLGEPGGAGENAEESTPEDEKKEPPPEDKELKDNHILNHVGLTDGPRSSI
ELDHLNFINNPYLTIHVPIASEESDLEMPTEEETDAFSEPEDIKKPLQPLYDGNSSVCST
ADYKPPEEDPEEQAEENPEGEQPEECFTEACVKRCPCLYVDISQGRGKMWWTLRRACFKI
VEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYIFILEMLLKWVAY
GFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMR
VVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCVNTTTSERFDISVVNNKS
ECESLMYTGQVRWMNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPDYEV
NLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGKDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPQNKIQGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYN
INMVFIIIFTGECVLKMFALRHYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLF
RVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYV
KKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPTLENPGTNVRGD
CGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLSEDDFEMFYETWEKF
DPDATQFIDYSRLSDFVDTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEV
LGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKQEEVCAIKIQRAYRRHLLQRSV
KQASYMYRHSQDGNGDGAPEKEGLLANTMNKMYGHEKEGDGVQSQGEEEKASTEDAGPTV
EPKPTSSSDTALTPSPPPLPPSSSPPQGQTVRPGVKESLV
NT seq 5523 nt   +upstreamnt  +downstreamnt
atggccagctcatctctgcccaacctggtccccccgggtccccactgcctgcgccccttc
accccagagtccctggcagccatagagcagcgggcggtggaggaggaggcccggctgcag
cggaacaagcagatggagattgaggagcctgagcggaagccacgcagtgacctggaagct
ggcaagaacctcccactcatctatggggaccccccacccgaagtcattggcatccccctg
gaggacctggatccttactacagtgacaagaagaccttcattgtgctcaacaaaggaaag
gccatcttccgattctctgccacgcctgccctctacctgctgagccccttcagcatcgtc
aggagggtggctatcaaggtgctcattcacgcgctgttcagcatgtttatcatgatcacc
atcctgaccaactgtgtgttcatgaccatgagcaatccgccttcttggtccaaacacgtg
gagtacaccttcacggggatctatacctttgagtccctcattaagatgctggcccgaggc
ttttgcattgatgacttcacattcctccgagacccctggaactggctggacttcagtgtc
atcacaatggcgtatgtgacagagtttgtggacttgggcaacatctcagccctgaggacc
ttccgtgtgctgcgggccctgaagaccatcacggttatcccagggctgaagacaattgtg
ggagccctgatccagtctgtgaaaaagctgtcggatgtgatgatcctcactgtcttctgc
ctgagtgtctttgccctggtggggctgcagcttttcatgggaaacctgcgtcagaagtgc
gtgcgttggcccccgcccatgaatgacaccaacaccacgtggtatggcaatgacacttgg
tacagcaatgacacttggtacggcaatgacacttggtacatcaatgacacttggaacagc
caggagagctgggccggcaactctacctttgactgggaggcctacatcaatgacgaaggg
aacttctatttcttggagggctccaatgatgctctgctctgtgggaatagcagtgatgct
gggcactgccctgagggctacgaatgcataaaggctgggcggaaccccaactatggctac
accagctatgacaccttcagctgggctttcctggctctcttccggctcatgacgcaggac
tactgggagaaccttttccagctgaccctacgagctgctggcaagacctacatgatcttc
ttcgtggtcatcatcttcctgggctccttctacctcatcaatctgatcctggccgtggtg
gccatggcgtacgctgagcagaatgaggctaccctggccgaagaccaggagaaagaggag
gagttccaacagatgcttgagaaatacaaaaaacatcaggaggaagtggaaaaggctaag
gctgcccaggctctggaaagtggagaggaggcagatggggacccaacccacaacaaagac
tgcaatgggagcctggatgcatccggggagaaggggcccccaaggccaagctgcagcgca
gacagtgccatctcagatgctatggaggagctggaagaggcccatcagaagtgcccaccg
tggtggtacaagtgtgcacacaaagtcctcatctggaactgctgtgccccgtgggtgaag
ttcaaacatataatctacctgatcgtcatggacccctttgtggacctgggtatcaccatc
tgcattgtgctcaacaccctcttcatggccatggagcactaccccatgaccgagcacttt
gacaacgtgctctccgtgggcaacttggtcttcacaggcatcttcactgcggagatggtg
ttgaagctgattgccatggacccctacgagtatttccaacagggctggaacatctttgac
agtttcatcgtcaccctcagcctggtggagctgggcctggccaacgtacaggggctgtca
gtgctccgttccttccgcctgctgcgtgtcttcaagctggccaagtcatggccaacactc
aacatgctcatcaaaatcattggcaactcagtgggcgcgctgggcaacctgaccctggtg
ctggccatcatcgtcttcatcttcgccgtggtgggcatgcagctgttcggcaagagctat
aaggagtgtgtgtgcaagatcgcctcagactgcaacctgcctcgctggcacatgaacgac
ttcttccactccttcctcatcgtcttccgcatcctctgcggggaatggatcgagaccatg
tgggactgcatggaggtggccggccaggccatgtgcctcaccgtcttcctcatggtcatg
gtcattggcaacctggtggtcctgaatctgttcctggctctcctgctgagttccttcagt
gctgacagcctggcggcctcggatgaggatggcgagatgaacaacctacagattgccatc
gggcgtatcaagtggggcatcggttttgccaaaaccttcctcctggggctgttgcgtggc
aagatcctgagccccaaggaaataatactcagcctcggtgagcccgggggtgccggggaa
aatgccgaggagagtactcccgaggatgagaagaaggagccgccaccggaagataaggag
ctgaaagacaatcatatcctgaaccacgtgggcctgaccgatggcccccgctccagcatc
gagctggaccaccttaacttcatcaacaacccctacctcaccatccacgtgcccattgcc
tccgaggagtctgacctggagatgcccacagaggaggagacagacgccttctcggagcct
gaggatatcaagaagcccctacagcccctctacgacgggaactcctccgtctgcagcaca
gctgactacaagccccctgaagaggaccccgaggagcaggctgaggagaaccccgagggg
gagcagcctgaggaatgcttcacggaagcctgtgtgaagcgctgcccctgcctctatgtg
gacatctcccagggccgtgggaaaatgtggtggacactgcgcagggcctgtttcaagatt
gttgagcacaactggtttgagaccttcattgtcttcatgatcttgctcagcagtggagcc
ctggccttcgaagacatctacattgaacagcgacgagtcatccgcaccatcctggaatac
gccgacaaggtcttcacctacatcttcatcctggagatgttgctaaagtgggtcgcctac
ggcttcaaggtgtatttcaccaatgcctggtgctggctcgacttcctcatcgtggacgtc
tccatcatcagcctggtggcaaactggctgggctactctgagctggggcccatcaaatcc
ctgcgcacactccgggccctgcgacctctgagggcactgtctcgatttgagggtatgagg
gtggtggtgaacgccctcctgggagctatcccctccatcatgaacgtcctcctcgtctgc
ctcatcttctggctcatcttcagcatcatgggggtcaacttgtttgctggaaagttctac
tactgcgtcaacaccaccacctctgagagattcgacatctcggtggtcaacaacaagtcc
gagtgtgagagcctcatgtatacaggccaggtccgctggatgaatgtcaaggtcaactac
gacaacgtgggtctgggctatctctccctccttcaggtggccacattcaagggttggatg
gatatcatgtatgcagctgtggactcccgggagaaagaggagcagccagactatgaggtg
aacctctacatgtacctctacttcgtcatcttcatcatcttcggctccttcttcaccctc
aacctcttcatcggtgtcatcatcgacaacttcaaccaacagaagaagaagtttggaggg
aaagacatcttcatgacagaggaacagaagaaatactacaacgcgatgaagaagcttggc
tccaagaagccccagaagccaattccccggcctcagaacaagatccagggcatggtgtac
gacttcgtgacgaagcaggtgtttgacatctccatcatgatcctcatctgcctcaacatg
gttactatgatggtggagacagatgaccagagccagctcaaggtggacatcctgtacaac
atcaacatggtcttcattatcatcttcacaggggagtgtgtgctgaagatgtttgcccta
cgccattactacttcaccattggctggaacatctttgactttgtggttgtcatcttgtcc
atcgtgggccttgcgctctctgacttgatacagaaatactttgtgtcacccacgctgttc
cgtgtgatccgcttggctcggatcgggcgtgtcctgcgtctgatccgcggggccaagggc
atccggacgctgctgttcgccctgatgatgtccctgcccgccctcttcaacatcggcctc
cttctctttctggtcatgttcatctactcgatcttcggcatgtctaacttcgcctacgtc
aagaaagagtcaggcatcgacgacatgtttaactttgagacctttggcaacagtatcatc
tgcctcttcgagatcaccacgtcagccggctgggacgggcttctgaaccccatcctcaac
agtgggcccccagactgtgacccgacgttggagaacccgggtaccaatgtcaggggggac
tgcggcaacccttccatcggcatctgtttcttctgcagctacatcatcatctccttcctc
atcgtggtcaacatgtacattgctatcatcctggagaatttcaacgtggccaccgaagag
agcagcgagcccctcagtgaggatgacttcgagatgttctatgagacctgggagaagttc
gacccggacgccactcagttcatcgactacagccgcctctcggactttgtggacaccctg
caggagccgctgaaaatcgccaaacccaataagatcaagcttatcacgttagacctgccc
atggtgcccggcgacaagatccactgcttggacatcctctttgccctgaccaaagaggta
ctgggtgactctggggagatggacgccctcaagcagaccatggaggagaagtttatggca
gctaacccttccaaggtctcctatgagcccatcaccaccaccctcaagaggaagcaggag
gaggtgtgtgctatcaaaatccagagggcctaccgccgccacctgctgcagcgctccgtg
aagcaggcctcttacatgtaccgtcacagccaggacggcaatggcgacggggcccccgag
aaggagggattgcttgccaacaccatgaacaagatgtatggccatgagaaagagggtgat
ggtgtgcagagccagggggaggaagagaaggcctctacagaggatgctggacccaccgtg
gagcccaaacccaccagcagctcagatactgccctgactccttctcctccaccactaccc
ccctcatcatcaccgccacaagggcagacagttcgcccaggggtcaaagagtctcttgtc
tag

DBGET integrated database retrieval system