KEGG   Rattus norvegicus (rat): 25734
Entry
25734             CDS       T01003                                 

Gene name
Hck, Hctk, p56Hck, p59Hck
Definition
(RefSeq) HCK proto-oncogene, Src family tyrosine kinase
  KO
K08893  hemopoietic cell kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    25734 (Hck)
   04062 Chemokine signaling pathway
    25734 (Hck)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    25734 (Hck)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25734 (Hck)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25734 (Hck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25734 (Hck)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   25734 (Hck)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    25734 (Hck)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 ABC1
Other DBs
NCBI-GeneID: 25734
NCBI-ProteinID: NP_037317
RGD: 2785
Ensembl: ENSRNOG00000009331
UniProt: P50545
Position
3q41
AA seq 524 aa
MGGRSSCEDPGCPRGEGRVPRMGCVKSRFLREGSKASKIEPNANQKGPVYVPDPTSPKKL
GPNSINSLPPGVVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEESGEWWKARSLAT
KKEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSL
SVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVVHYKKGKDGLCQKLSVPCV
SPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKTLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFS
AQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC
PEELYSIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1575 nt   +upstreamnt  +downstreamnt
ctggggggtcgttcgagctgcgaggatccgggctgcccgcgaggcgaagggcgggtgccc
aggatgggatgtgtgaagtccaggttcctccgagaaggaagcaaggcctcaaaaatagag
ccaaatgccaaccagaaaggccctgtgtatgtgccggatcccacgtcccctaagaagctg
ggaccgaacagcatcaacagcctgcccccgggggtcgtggagggctctgaggacaccatt
gtggtcgcactgtacgactatgaggccattcaccgtgaagacctcagcttccagaaggga
gaccagatggtggttctggaggagtctggggagtggtggaaggcccgttccctggctacc
aagaaagaaggctatatcccaagcaattatgtagctcgagttaactctttggagactgag
gagtggttcttcaagggtatcagccggaaggatgcagagcgccacctgctggctcccggg
aacatgctgggctccttcatgatccgggacagtgagaccaccaaagggagctactcactt
tctgttcgagactttgacccccagcacggagacacggtgaagcattataaaatccggaca
ctggacagtggaggcttctacatctctccgaggagcaccttcagcagcctgcaggaactt
gtcgtccactacaagaaggggaaggatgggctctgccagaagctgtcagtgccctgtgtg
tctcccaaaccccagaagccatgggagaaagatgcctgggagattcctcgagaatccctc
cagatggagaagaaactgggagccgggcagtttggagaagtgtggatggccacctacaac
aagcacaccaaagtggcggtgaagacaatgaagccagggagcatgtctgtggaggccttc
ctggcagaggccaacctgatgaagacgttacagcatgataaactggtgaagctgcacgcc
gtggtctctcaggagcccatctttattgtcaccgagttcatggccaaaggaagcctgctg
gactttctcaagagtgaagaaggcagcaagcagccactgccaaaactcattgacttctca
gcccagatttcagagggcatggctttcattgagcagaggaactacatccaccgagacctc
cgggctgccaacatcttggtttctgcatcactggtgtgtaagatcgctgactttggactg
gcacggatcatcgaggacaatgagtacacagctcgggaaggagccaagttccccatcaag
tggacagctcctgaagccatcaactttggctccttcaccatcaagtcagatgtctggtcc
tttggtatcctgctgatggaaatcgtcacctacggccggatcccttacccaggtatgtca
aacccagaggtgattcgagcactagagcatgggtaccgtatgcctcgaccagataactgc
ccagaggagctctacagtatcatgatccgctgctggaagaaccgtccagaggaacggccc
actttcgaatacatccagagcgtgctggatgacttctacacggccactgagagccagtat
cagcagcaaccttga

DBGET integrated database retrieval system