KEGG   Rattus norvegicus (rat): 260326Help
Entry
260326            CDS       T01003                                 

Gene name
Adgrg1, Gpr56
Definition
(RefSeq) adhesion G protein-coupled receptor G1
  KO
K08450  adhesion G-protein coupled receptor G1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    260326 (Adgrg1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    260326 (Adgrg1)
Peptidases [BR:rno01002]
 Mixed Peptidases
  Family P2
   260326 (Adgrg1)
G protein-coupled receptors [BR:rno04030]
 Adhesion receptor family
  Others
   260326 (Adgrg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLL 7tm_2 GAIN_A GPS
Motif
Other DBs
NCBI-GeneID: 260326
NCBI-ProteinID: NP_689448
RGD: 628617
Ensembl: ENSRNOG00000014963
UniProt: F1LMW3
Position
19p13
AA seq 687 aa AA seqDB search
MAVQVLLQMVYFLLTLLFLVQGAHGASPREDFRFCGQRNQTRQSNLHYDQTSEPHIFVWN
TDESLTIRAPFPAAPDIPYFFPEPRGLYHFCLYWSRHTGRLHLRYGKNDYLLSSRASNLL
CYRKQEESLKQGAPLVATSVSSWQSPQNTSLPGAPSFIFSFHNAPHKVSHNASVNMCDLK
KELQLLSKFLQHPHKASKRPSAAFISQQLQNLESKLTSVSFLGDTLSFEENRVNATVWKL
PPTAGLEDLQIHSQQEEEQSEVQAYSVLLPRAVFQQTRGRRRDAAKRLLVVDFSSQALFQ
DKNSSQVLGEKVLGIVVQNTKVTNLSDPVVLTFQHQPQPKNVTLQCVFWVEDPTSSSPGS
WSSEGCETVSRDTQTSCLCNHLTYFAVLMVSSMEVEATHKHYLTLLSYVGCVISALACVF
TIAAYLCTRRKSRDYTIKVHMNLLLAVFLLDVSFLLSEPVALMGSEAACRTSAMFLHFSL
LACLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSTVGWGFPVFLVTLVALVDVNNYGPII
LAVRRTPDHVIYPSMCWIRDSVVSYVTNLGLFSLVILFNMAMLATMVVQILRLRPHSQKW
PHVLTLLGLSLVLGLPWALVFFSFASGTFQLVIIYLFSIMTSFQGFLIFLWYWSMRFQAQ
GGPSPLKNNSDSAKLPISSGSTSSSRI
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccaggtgctactgcagatggtctacttcctactgactctgctctttctggtg
caaggtgcccatggtgccagcccccgagaagacttccgcttctgtggccagcggaaccag
acacgtcagagcaacctccattatgatcaaacttcagagcctcacatttttgtatggaac
acagacgagagcctcacgatccgtgccccattcccggcagccccagacattccctacttc
ttcccggaacctagaggactctatcatttctgcctctactggagccgccacactgggagg
ctccacctgcgctatggcaagaatgattacctgcttagtagccgagcctccaacctcctc
tgctaccggaaacaggaggagagcctgaaacagggggctccactggttgccacctctgtc
agctcctggcagagcccacagaacaccagcctgccgggagctccaagcttcatcttctcc
ttccataatgccccacataaggtctcccacaatgcatctgtgaacatgtgtgacctcaag
aaggaactgcagttgcttagcaagttcctgcagcatcctcacaaggcctccaagcggccc
tcggcagcgttcatcagtcagcagttgcagaacctagagtcaaagctgacctccgtgagc
ttcctgggagacacactgtcttttgaggagaaccgggtcaatgccacagtgtggaagctg
ccacccacagccgggctggaggatctgcaaatccactcccagcaggaggaggagcagagt
gaggtccaggcctactccgtgttgcttccccgggccgtattccagcagaccagaggccgt
cgccgggatgccgccaagaggctcctggtagtcgacttcagcagccaagctttgttccag
gacaagaattctagccaagtcctgggtgagaaggtcttgggtatcgtcgtgcagaacacc
aaagtcactaacctctcagatcccgtggtactcaccttccagcaccagccacagccaaag
aacgtgactctgcagtgtgtgttctgggttgaagacccgacatcaagcagccctgggagc
tggagcagtgagggctgtgagactgttagcagagacacacagacatcctgcctgtgtaac
catctgacctactttgcagtgctgatggtgtcatccatggaggtagaagccactcacaaa
cactacctcacgctcctgtcctacgtgggctgtgtcatctctgccctagcttgtgtcttc
accatcgctgcgtacctgtgcaccaggaggaagtcacgtgactacaccatcaaagtgcac
atgaacctgcttctggccgtcttcctcctggacgtgagcttcctgctcagtgagcccgtg
gcgctgatgggctctgaagcagcctgtcgcaccagtgccatgttcctgcacttctccctg
cttgcctgcctctcctggatgggcctggagggctacaatctctaccgactggtggtggag
gtcttcggtacctatgtccctggctatctgctcaagctgagcaccgtgggctggggtttt
cctgtcttcctggtcactctggtggcgttggtcgacgtgaataactatggccccatcatc
ctagctgtgcgccggactccggaccatgtcatctacccctctatgtgctggatccgggac
tctgtagttagctatgtcactaacctgggcctcttcagcctggtgatcctgttcaacatg
gctatgctggccaccatggtggtgcagatcctgcggcttcgcccacacagccagaagtgg
ccccacgtgctgactttgctgggcctcagcctggtccttggccttccctgggccttggtc
ttcttttcctttgcttctggtaccttccagcttgtcatcatctaccttttcagcatcatg
acttccttccaaggcttcctcatcttcctgtggtactggtccatgaggttccaggcccaa
ggcggtccctctcctctgaagaacaattcagacagcgccaagctccccatcagctccggc
agcacctcttccagccgcatctag

DBGET integrated database retrieval system