KEGG   Rattus norvegicus (rat): 260327
Entry
260327            CDS       T01003                                 

Gene name
Fndc5
Definition
(RefSeq) fibronectin type III domain-containing protein 5 precursor
  KO
K24486  fibronectin type III domain-containing protein 4/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    260327 (Fndc5)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   260327 (Fndc5)
SSDB
Motif
Pfam: fn3 DUF4808 Sigma_reg_N Interfer-bind
Other DBs
NCBI-GeneID: 260327
NCBI-ProteinID: NP_001257910
RGD: 708525
Ensembl: ENSRNOG00000030238
UniProt: Q8K3V5
Position
5
AA seq 209 aa
MPPGPCAWPPRAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVI
GFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFK
TPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNE
PNNNKEKTKSASETSTPEHQGGGLLRSKI
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcccccagggccgtgcgcctggccgccccgcgccgctctccggctgtggctgggctgc
gtgtgcttcgcgctggtgcaggcggacagcccctcggcccccgtgaacgtaaccgtcagg
cacctcaaggccaactcggcagtggtcagctgggacgtcctggaggacgaggttgtcatc
ggctttgccatctctcagcagaagaaggatgtgaggatgctgcgcttcattcaggaggtg
aacaccaccacccgatcctgcgctctctgggacctggaggaggacacagagtatatcgtc
cacgtgcaggccatctccatccagggccagagcccagccagtgagcccgtgctcttcaag
accccacgtgaggccgagaagatggcctctaagaacaaagatgaggtgaccatgaaggag
atggggaggaaccagcagctgcggacgggcgaggtgctgatcatcgtcgtggtcctcttc
atgtgggcaggtgtcatagctctcttctgccgccagtatgacatcatcaaggacaacgag
cccaataacaacaaggaaaaaaccaagagtgcatcagagaccagcaccccagagcaccag
ggtgggggtctcctccgaagcaagatatga

DBGET integrated database retrieval system