KEGG   Rattus norvegicus (rat): 266608
Entry
266608            CDS       T01003                                 

Gene name
Fzd9, rFz9
Definition
(RefSeq) frizzled class receptor 9
  KO
K02842  frizzled 9/10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    266608 (Fzd9)
   04390 Hippo signaling pathway
    266608 (Fzd9)
   04150 mTOR signaling pathway
    266608 (Fzd9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    266608 (Fzd9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    266608 (Fzd9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    266608 (Fzd9)
   05205 Proteoglycans in cancer
    266608 (Fzd9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    266608 (Fzd9)
   05226 Gastric cancer
    266608 (Fzd9)
   05217 Basal cell carcinoma
    266608 (Fzd9)
   05224 Breast cancer
    266608 (Fzd9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    266608 (Fzd9)
   05022 Pathways of neurodegeneration - multiple diseases
    266608 (Fzd9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    266608 (Fzd9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    266608 (Fzd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    266608 (Fzd9)
   04090 CD molecules [BR:rno04090]
    266608 (Fzd9)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  266608 (Fzd9)
CD molecules [BR:rno04090]
 Proteins
  266608 (Fzd9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 266608
NCBI-ProteinID: NP_695217
RGD: 628817
Ensembl: ENSRNOG00000001452
UniProt: Q8K4C8
Position
12q12
AA seq 592 aa
MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPN
LLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQAR
LRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRP
ARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWS
ALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAG
ALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFH
MAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLT
GFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLR
ATEQPCTAAAVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQS
LCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggcggtgccaccgctgctccgcggggcgctgctgctgtggcagctgctggcgacgggc
ggcgcggcgctggagatcggccgctttgatccggagcgcggccgtggccccgcaccgtgc
caagcgatggagatccccatgtgccggggcatcggctacaacctgacccgcatgcccaac
ctactgggccacacgtcgcagggcgaggcggccgcgcagctggccgagttctcgcctctc
gtgcagtacggctgccacagccacctgcgcttcttcctctgctcgctctacgccccaatg
tgcaccgaccaggtctccactcccatccccgcctgccggcccatgtgcgagcaggctcgc
ctgcgctgcgcccccatcatggagcaattcaatttcggctggccggactccctcgactgt
gcccggctccccacgcgcaacgacccgcacgcgctctgcatggaggcacccgagaacgct
accgcaggccccacagaaccccacaagggcctgggcatgcttcctgtagcacctcggccc
gcgaggccaccgggagattcagcccccggtccgggcagtggaggcacctgcgacaacccc
gagaagttccagtacgtggagaagagtcgctcgtgcgctccgcgctgcgggccaggcgtc
gaggtgttctggtctcggcgcgataaggacttcgcgctggtctggatggctgtgtggtcc
gcgttgtgtttcttctccacggccttcaccgtgttcaccttcctgctggagcctcaccga
ttccagtacccagagcgccctataatcttcctttccatgtgctacaatgtctactccttg
gccttcctgatcagagcggtggcaggtgcacagagtgtggcctgcgaccaggaggcaggg
gctctgtatgtgatccaggagggtttggaaaacacaggctgcaccctggtcttcctattg
ctctattatttcgggatggccagctcactttggtgggtggttttgactctcacctggttc
ctggctgcaggcaaaaagtggggccacgaagccatcgaggctcacggtagttacttccac
atggcagcgtggggcttgccagcactcaagactatcgtggtcctgactctacgtaaggtg
gctggggatgagctgactgggctctgctatgtagctagcatggacccggcagctctcact
ggctttgtgttggtgcccctctcttgctacttggtactgggcaccagtttcctcctgaca
ggttttgtggctctcttccatatccgcaaaattatgaagacgggcggcaccaatacagag
aagctggagaagctgatggtgaaaatcggagtcttttccatcctttacacagtgccggct
acctgcgtcattgtctgctatgtttacgaacgcctcaacatggacttctggcgtcttcgg
gccacagagcaaccatgcactgccgctgccgtgcctggaggccggagagactgctcgctg
ccagggggctcggtgcccactgtggccgtcttcatgctcaaaatcttcatgtccttggtg
gtgggcatcaccagtggagtctgggtatggagttccaagactttccagacttggcagagt
ctatgttaccgaaaaatggcagctggtcgagcccgggccaaggcctgccgaaccccaggg
ggctatggccggggtacccactgtcactacaaagcccccacggtggtcttgcacatgact
aagacagacccctctctggagaaccccacacacctctag

DBGET integrated database retrieval system