KEGG   Rattus norvegicus (rat): 266680
Entry
266680            CDS       T01003                                 

Gene name
St18, Nzf3, r-MyT3
Definition
(RefSeq) suppression of tumorigenicity 18
  KO
K24386  suppression of tumorigenicity 18 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    266680 (St18)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    266680 (St18)
SSDB
Motif
Pfam: zf-C2HC MYT1 ATG16 YabA ADIP DUF812 CENP-H DUF1664 HAUS-augmin3 FapA SlyX TMCO5 Tho2 DUF16 DUF3450
Other DBs
NCBI-GeneID: 266680
NCBI-ProteinID: NP_695222
RGD: 708566
Ensembl: ENSRNOG00000006200
UniProt: Q9QX27
Position
5q12
AA seq 1044 aa
MDAEVEDKALHTLSKGTEVPMDSLIPELRVAYDCSMAKKRRAEEQALGVPVNKRKSLLMK
PRHYSPDMDCKENPDNRNEDDGLETNDHSTADEIVVKPMDKTLHLPAQESSLPKEDQYAC
YPELMVKSLMHLGKFEESESVQTVGENLNGNGIQSLKAECDEANECFMVHSDDGRDKVHH
SQPPFCSSGDSESDSDNTENGWGSGSNSSEDTDTHKGPKRKLTYNRKDLLEVPEIKAEDD
KFIPCENRCDSDTSGRDPQNSHMEPLAVKVQPSFPEVEESESLATVIAESAEVEKAKGSL
SLLEQAIALQAERGSVFHHTYKELDRFLLDHLARQRRQPKVTDASGRQIFNNKHSPRPER
REAKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHV
NSNRNTHRSLSGCPIAAAEKLAMTQDKSQLDSSQTGQGPEQAHRVNLVKQIEFNFRSQAI
TSPRASASKEQEKFGKVPFDYASFDAQVFGKRPLLQTGQGQKAPPFPESKHFSNPVKFSN
GLPSAGAHTQSTVRASSYGHGQYSEDTHIAAAAAILNLSTRCREATDILSNKPQSLRAKG
AEIEVDENGTLDLSMKKHRILDKSIPPTSSHTTIATPSSSPFKASSLLVNAAFYQALCDQ
EGWNVPINYSKSHGKTEEEKEKDPVNSLENLEEKKFAGEASIPSPKPKLHTRDLKKELIT
CPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNY
ASHRSLSGCPRARKGGIKMTPTKEEKEDSELRCPVIGCDGQGHISGKYTSHRTASGCPLA
AKRQKENPLNGTPLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQAIKKV
KVSEELMTIKLKATGGIEGDEEIRHLDEEIKELNESNLKIEADMMKLQTQITSMESNLKT
IEEENKLIEQSNESLLKELAGLSQALISSLADIQLPQMGPINEQNFEAYVNTLTDMYSNL
ERDYSPECKALLESIKQAVKGIHV
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggatgcagaggttgaagataaagcgttgcatactctctcaaaaggaaccgaagttcca
atggattctctgatcccagagctcagggttgcatatgattgctctatggcgaagaagagg
agagctgaagagcaggcattgggagtgccagttaacaagaggaaatctctgttaatgaaa
ccccggcactacagcccagacatggactgcaaggaaaacccagacaacaggaatgaggat
gatggcctagaaacgaatgaccactccactgcagatgaaatcgtggtaaaacccatggat
aagactcttcatttacctgcacaagaaagctcactccccaaggaagaccaatacgcgtgt
tatccagagctcatggtcaaatctctgatgcatttaggtaaatttgaagaaagtgagtct
gtgcagaccgtaggtgagaacttaaatggcaacggcatccagtctctaaaagcagagtgt
gatgaagcaaatgaatgctttatggttcattctgatgatggaagagacaaagtccaccat
tcccagccacctttctgctcttccggtgacagtgagagtgactctgacaatacagagaat
gggtggggcagtggctccaactcttcagaagacactgacactcacaaaggccccaaacgc
aagctgacatacaatagaaaggacctgctggaagtccctgagataaaagcagaagatgac
aagtttatcccttgcgagaacaggtgtgattctgacaccagtgggagagacccacagaac
tctcacatggaacccttggctgtgaaagtccagccttccttcccagaggttgaagagagt
gagagcctggccacagtaatagcggagtctgctgaggtggagaaagcgaaggggagcctg
agtttgctggaacaggctattgccctacaggctgaacggggttccgtcttccatcacacc
tacaaagagctggaccgatttctcctggaccacctggcaaggcaacggaggcaacccaag
gttactgatgccagtggaaggcaaatctttaataataaacattcaccaaggcctgaaagg
agggaggctaagtgccccattcctggctgtgacggcacagggcacgtaacggggctctac
ccccaccaccgcagcctttctgggtgcccccacaaagtgcgagttcctctggaaattctt
gccatgcatgagaacgtactcaagtgtcccaccccaggatgcacaggaaggggacatgtg
aacagcaatcgcaacactcacagaagtctttctggttgtccaattgctgcagctgaaaag
ttggcaatgacccaggacaaaagtcaacttgattcttcccagactgggcagggtcctgag
caggctcacagggtgaatttagtgaagcaaattgaatttaacttccgctcacaagccatc
acctctccaagagcctctgcatcaaaagaacaagagaagtttggcaaagtaccatttgat
tatgccagttttgatgcacaagtatttggtaaacgtccgctcctacaaacaggacaagga
caaaaggcaccaccatttcctgaatcaaagcatttttcaaatccagtgaaattttctaat
gggctgcctagtgctggcgcccacacacagagcacagtccgtgccagctcttatggccat
ggtcagtacagtgaagacacccacatagcagcagctgctgctatcctgaacctttccacc
cgctgcagggaagccacagacatcctctccaacaaaccgcaaagcctgcgtgccaaggga
gctgagatagaagtggatgaaaacggcacgttggacttaagcatgaaaaaacatcgaatc
ctcgacaagtctatacccccgacttcctcacacactacaattgcaaccccatcctcatcc
ccattcaaagcaagcagccttctggtcaatgctgccttctatcaggctctctgtgaccaa
gaaggctggaatgtgcctatcaactatagcaaatcccacgggaagacagaggaggagaaa
gagaaagaccctgtgaactccctagaaaatttagaggaaaaaaagtttgctggagaggcc
tctattccaagtccaaagcccaagctccacacacgagatctcaagaaagaattaatcacc
tgccccacgccagggtgtgatggaagcggccatgtcacaggcaactatgcatctcaccgc
agtgtctctggatgtcctctagcagataagactctgaagtccctcatggctgccaactct
caagagcttaagtgtccaaccccgggttgtgatggttctggtcacgtgactggaaactat
gcctcccatagaagcttgtctggttgccctcgtgcaaggaaaggtggcatcaaaatgacc
ccaacaaaggaagaaaaagaagactctgagcttagatgtcctgtaataggatgtgacggc
caaggtcacatatcaggtaaatacacatcacaccgcacagcttctggctgtcctctggct
gccaagagacagaaggagaatcccctcaatgggacccctctctcatggaaactgaacaag
caagaacttccccactgtcctttgccaggatgcaatggtctgggtcatgtaaacaacgtt
tttgtcacccacaggagcttatccggatgccctcttaatgcacaagctatcaaaaaagtc
aaggtctctgaggaactaatgaccatcaagctcaaagcaactgggggtattgagggtgat
gaagaaattaggcatctggatgaagaaataaaggaactgaatgaatccaaccttaaaatt
gaagcagatatgatgaaacttcagacccagataacatctatggagagcaacttgaagacc
atagaggaggagaacaagcttatagagcagagcaacgagagtctactgaaggagctggca
gggcttagccaggctctcatctccagtcttgctgacatccagcttccacagatgggtcct
atcaatgagcagaattttgaagcatatgtaaatactctcacagacatgtacagcaatctg
gaacgggactattccccagaatgcaaagctctactggaaagcatcaagcaggcagtgaaa
ggtatccatgtgtag

DBGET integrated database retrieval system