KEGG   Rattus norvegicus (rat): 266772Help
Entry
266772            CDS       T01003                                 

Gene name
Klhl12, C3ip1
Definition
(RefSeq) kelch-like family member 12
  KO
K10450  kelch-like protein 12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    266772 (Klhl12)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     266772 (Klhl12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_2 Kelch_3 Kelch_4 Kelch_5
Motif
Other DBs
NCBI-GeneID: 266772
NCBI-ProteinID: NP_714952
RGD: 628717
Ensembl: ENSRNOG00000004193
UniProt: Q8R2H4
Position
13q13
AA seq 568 aa AA seqDB search
MGGIMAPKDIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYFCA
MFTSELSEKGKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVKQ
ACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVE
KLIKCDEIQVDSEEPVFEAVINWVKHAKKEREESLPDLLQYVRMPLLTPRYITDVIDAEP
FIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEVLLVVGGFGSQQSPIDVVE
KYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWY
SVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAG
LVVASGIIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGG
FDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECY
DPIIDSWEVVASMGTQRCDAGVCVLREK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcattatggcccctaaagacataatgacaaatactcacgccaagtccatcctc
aactcaatgaactccctcaggaagagcaataccctctgtgacgtgaccttgagagtggag
cagaaagacttccctgcccaccggattgtgctggctgcctgcagcgattatttctgtgcc
atgttcactagtgagctttcagagaaggggaagccatatgttgacattcaaggtttaact
gcttctacaatggaaatcctgttggacttcgtgtatacagaaacagtacatgtgacagtg
gagaatgttcaagaactgctccctgcagcctgtcttctccagttgaaaggtgtaaaacaa
gcctgctgtgagttcttagaaagtcagttggatccatctaattgcctgggtatcagggat
tttgctgaaactcacaattgcgttgacctgatgcaagcagctgaggtttttagccagaag
cattttcctgaagtggtacagcacgaagagttcattcttctgagtcaaggagaggtggag
aagctaatcaagtgcgatgagattcaggtggattctgaagagccagtctttgaggctgtc
atcaactgggtgaagcatgccaagaaggagcgagaggagtctttgcctgacctcctgcag
tatgttcggatgcccctgctgacccctaggtacattacagatgtgattgatgctgagcct
tttatccgctgtagtttacagtgcagggacctagttgatgaagccaagaagtttcacctg
aggcctgaacttcggagtcagatgcaaggacccaggacaagagcccgactaggagccaat
gaagtgcttctggtggttgggggcttcggaagccagcagtctcctattgatgtggtagag
aaatatgaccccaagacacaggagtggagctttttgccaagtatcactcgcaagagacgg
tatgtggcctcggtttccttacatgatcggatctatgtgattggtggctatgatggccgt
tcccgcctcagttcagtggagtgtctagactacacagcagatgaagacggagtgtggtac
tctgtggcccctatgaatgtgcggcgaggccttgctggagccaccacactgggagatatg
atttacgtttctggaggctttgatggaagcaggcgtcatacaagtatggagcggtatgac
ccaaacattgaccagtggagtatgctgggagatatgcagacagctcgagagggcgcggga
ctagtggtggccagcggcataatctactgtctaggaggatatgatggcttgaatatatta
aattcagttgagaaatatgatccccatacaggacactggactaatgttacgcctatggcc
accaagcgttctggtgctggagtagccctactgaatgaccatatttatgtggtgggaggg
ttcgatggtacagcccacctttcttctgttgaagcttataacattcgcacggattcctgg
acaactgtcacaagtatgaccacaccacgatgctatgtaggggccacagtgcttcgaggg
agactctatgcaatcgcaggatacgatgggaattctctgctgagcagcattgagtgttat
gaccctatcatcgacagctgggaagtagtggcctccatgggaacccagcgttgtgacgct
ggtgtgtgtgttctccgagaaaagtaa

DBGET integrated database retrieval system