KEGG   Rattus norvegicus (rat): 266805
Entry
266805            CDS       T01003                                 

Gene name
Has3
Definition
(RefSeq) hyaluronan synthase 3
  KO
K00752  hyaluronan synthase [EC:2.4.1.212]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    266805 (Has3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.212  hyaluronan synthase
     266805 (Has3)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   266805 (Has3)
SSDB
Motif
Pfam: Glyco_tranf_2_3 Chitin_synth_2 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Other DBs
NCBI-GeneID: 266805
NCBI-ProteinID: NP_758822
RGD: 628656
Ensembl: ENSRNOG00000059362
UniProt: Q8CH92
Position
19q12
AA seq 554 aa
MPVQLTTALRVVGTSLFALVVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS
LFAFLEHRRMRRAGRPLKLHCSQRRRSVALCIAAYQEDPEYLRKCLRSAQRIAFPNLKVV
MVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMERVRAVVW
ASTFSCIMQKWGGKREVMYTAFKALGNSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVG
GVGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFL
EDWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSK
SYFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLV
GIIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFI
GLIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRC
GKKPEQYSLAFAEV
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgccggtgcagctgactacagcccttcgtgtggtgggcaccagtctgtttgccctggta
gtgctggggggcatcctggcagcctatgtcacaggctaccagtttatccacacggaaaag
cactatctgtccttcggcctctacggtgccatcctgggtctgcatctgctcatccagagc
ctgtttgccttcctggagcaccgtcgcatgcgcagggcagggcgcccactgaagctgcac
tgctctcagagacggcgttcggtggcactctgcatcgctgcctaccaagaggaccctgag
tacttgcgcaagtgccttcgctcagctcagcgcattgccttcccaaacctcaaggtggtc
atggtagtggatggcaatcgccaggaagatgcctacatgctggacatcttccatgaggtc
ctgggtggcactgagcaagctggcttctttgtgtggcgtagcaatttccatgaggcgggt
gaaggagagacagaggccagcttgcaggaaggcatggagcgtgttcgagctgtggtgtgg
gccagcaccttctcatgcatcatgcagaagtgggggggcaagcgtgaagtcatgtacaca
gctttcaaggcccttggcaactcagtggactacatccaggtgtgtgactctgacactgtg
ctggacccagcctgcaccattgagatgcttcgggtcttggaggaagatccccaagtagga
ggtgttggaggagatgtccaaatcctcaacaaatacgattcatggatctccttcctgagc
agcgtgaggtactggatggccttcaacgtggagcgggcctgccagtcctactttggctgt
gtgcagtgtattagtgggcctctgggcatgtaccgcaacagcctccttcagcagttcctg
gaggactggtaccatcagaagttcctaggcagcaagtgcagctttggggatgatcggcac
cttaccaaccgagtcctgagtcttggctaccggactaagtatacagcacgctccaagtgc
ctcacagagacccccactaagtatctccgatggctcaaccagcagacccgctggagcaag
tcttactttcgggagtggctctacaactctctgtggttccataagcaccacctgtggatg
acctatgagtcagtggtcacaggcttcttccccttcttcctcatcgccacagtcatacaa
cttttctaccgtggccgcatctggaacattctcctcttcctactaacggtgcagctggtg
ggcattatcaaggctacctatgcctgcttcctccgaggcaatgcagagatgatcttcatg
tccctctactcccttctctatatgtccagcctgctgccagccaagatctttgctattgct
accatcaacaagtctggctggggcacttctggcaggaaaaccattgtagtgaacttcatt
ggcctaatccctgtgtccatctgggtggcagttcttctaggggggttagcctacacagct
tattgtcaggacctgttcagtgagactgagctagccttcctggtctctggggccatcttg
tatggctgctactgggtggccctcctcatgctgtatttggccattattgcccggaggtgt
gggaaaaagccagaacagtatagcctggcttttgctgaggtgtga

DBGET integrated database retrieval system