KEGG   Rattus norvegicus (rat): 27064
Entry
27064             CDS       T01003                                 

Gene name
Ankrd1, Alrp, Carp, Crap, MARP
Definition
(RefSeq) ankyrin repeat domain 1
  KO
K21433  ankyrin repeat domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    27064 (Ankrd1)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    27064 (Ankrd1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 27064
NCBI-ProteinID: NP_037352
RGD: 61989
Ensembl: ENSRNOG00000018598
UniProt: Q8R560
Position
1q53
AA seq 319 aa
MMVFRVEELVTGKKNSNGSSGEFLPGEFRNGEYEAAVALEKQEDLKTLPANSVNLGEEQR
KSEKVREAELKKKKLEQRSKLENLEDLEIIVQLKKRKKYKKTKVPVVKEPEPEIITEPVD
VPRFLKAALENKLPVVEKFLSDKNSPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIE
FRDMLESTAIHWACRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIA
CEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTFGADLNVKNCAGKIPMDLVLHWQNGTK
AIFDSLKENAYKNSRIATF
NT seq 960 nt   +upstreamnt  +downstreamnt
atgatggtttttcgagtagaggagctggtaacgggcaaaaagaacagcaatgggtcctca
ggggagttccttcctggcgagttcagaaatggagagtatgaagctgctgttgccttggag
aaacaagaggacttgaagacacttccagccaacagtgtgaacctgggggaagaacaacgg
aaaagtgagaaagttcgagaggcagagctcaaaaagaaaaaactagaacaaagatcaaag
cttgaaaacttagaagaccttgaaataattgttcaactgaagaaaagaaaaaaatacaag
aaaactaaagttccagttgtgaaggaaccggagcctgaaattattactgaacctgtggat
gtgccaaggtttctgaaagctgcactggagaacaaactgccagttgtagagaaattcctg
tcagacaagaacagccccgacgtctgcgatgagtataaacggaccgctctccatagagca
tgcttagaaggacacttggcgatcgtggagaagttaatggaggctggagcccagattgaa
ttccgagatatgctggaatccacagccatccactgggcatgtcgtggaggaaacctggat
gtcctgaaactgttgctaaacaaaggtgccaaaatcagtgcccgagacaagctgctcagc
acagcgctgcacgtggcggtgaggaccggtcactacgagtgtgctgagcacctcatcgcc
tgcgaggcggatctcaatgccaaggacagagaaggagacacccctctgcatgatgcggtg
aggttgaatcgctacaagatgatccggctcttgatgaccttcggtgcggacctcaatgtc
aagaactgtgctgggaagatccctatggatctggtgttgcactggcagaatggaaccaaa
gcgatattcgacagcctcaaggagaatgcctacaaaaactcgcgcatagctacgttctga

DBGET integrated database retrieval system