KEGG   Rattus norvegicus (rat): 27100
Entry
27100             CDS       T01003                                 

Gene name
Gfer, ALR
Definition
(RefSeq) growth factor, augmenter of liver regeneration
  KO
K17783  mitochondrial FAD-linked sulfhydryl oxidase [EC:1.8.3.2]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    27100 (Gfer)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     27100 (Gfer)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Mitochondrial intermembrane space assembly (MIA) complex
    27100 (Gfer)
SSDB
Motif
Pfam: Evr1_Alr APOBEC4 FAD_SOX SNAD4
Other DBs
NCBI-GeneID: 27100
NCBI-ProteinID: NP_037354
RGD: 61845
Ensembl: ENSRNOG00000013370
UniProt: Q63042
Structure
PDB: 
1OQC 3R7C

Position
10q12
AA seq 198 aa
MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHG
KRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQ
DMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFD
CSRVDERWRDGWKDGSCD
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcggcgcccagcgaacccgcaggtttccctcgcggcagtcgcttctccttcctgccg
ggcggcgcgcactcggagatgaccgacgacctggtgactgacgcgcggggccgcggcgca
aggcatagaaaagacaacgcccctgccgcggccccggcgccgaaaggtttggagcacggg
aagcgaccgtgccgggcctgcgtggacttcaagtcgtggatgcggacccagcagaagcgg
gacatcaagtttagggaggactgtccacaggatcgggaagaattgggtcgcaacacctgg
gctttccttcatacgctggccgcctattacccggacatgcccacgccagaacaacagcag
gatatggcccagttcatacatatattttccaagttttacccctgtgaggagtgtgcagaa
gacataaggaagaggatagacaggagccagccagacacaagcactcgagtgtccttcagc
cagtggctgtgccgccttcacaatgaagtgaaccggaagctgggcaagcctgattttgac
tgctcaagagttgatgagcgatggcgtgacggctggaaggacggctcctgtgactaa

DBGET integrated database retrieval system