KEGG   Rattus norvegicus (rat): 282587
Entry
282587            CDS       T01003                                 

Gene name
Cttnbp2, Cbp90, Cortbp2
Definition
(RefSeq) cortactin binding protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Ank_2 CortBP2 Ank_4 Ank_5 Ank Ank_3 Carmo_coat_C DUF1980
Other DBs
NCBI-GeneID: 282587
NCBI-ProteinID: NP_001107873
RGD: 628691
Ensembl: ENSRNOG00000061845
UniProt: Q2IBD4
Position
4q21
AA seq 1649 aa
MATDSASCEPDLSRAPGDAEGATAEAAKKEFDVDTLSKSELRMLLSVMEGELEARDLVIE
ALRARRKEVFIQERYGRFNLNDPFLALQRDYEAGAGDKEKPVCTNPLSILEAVMAHCRKM
QERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAAHLEEERGKNKHVVLMLVKECKQL
SGKVVEEAQKLEEVMVKLEEEKKKTSELEDQLSAEKQRSAGMEAQLEKQLFEFDTEREQL
RAKLTREEAHTTDLKEEIDKMKKMMEQMKKGNDGKPGLSLPRKTKDKRLASISVATEGPV
TRSVACQTDVVTESTDPVKKLPLSVPIKPSTGSPLVSTNTKGNVGPSALLIRPGIDRQAS
HSDLGPSPPTALPSSASRIEENGPSAGNAPDLSNSTPSTPSGTAPAAAQTLGAAPQNHSQ
APPVHSLHSPCANTHPGLNPRIQAARFRFQGNANDPDQNGNNTQSPPSRDVSPTSRDNLV
AKQLARNTVTQALSRFTSPQAGASSRLGASPGGDAGTCPPVGRTGLKTPGAARVDRGNPP
PIPPKKPGLSQTPSPPHPQLRASNAGAKVDNKIVASPPSTLPQGTKVVNEENVPKSSSPQ
LPPKPSIDLTVASAGCPVSALATSQVGAWPAETPGLNQPACTDSSLVIPTTVAFRSSINP
VSASSRSPGASDSLLVTASGWSPSLTPLLMSGGPAPLAGRPTLLQQAAAQGNVTLLSMLL
NEEGLDINYCCEDSHSALYSAAKNGHTDCVRLLLNAEARVDAADKNGFTPLCVAAAQGHF
ECIELLTAYNANINHSAAGGQTPLYLACKTGNKECIKLLLEAGTDRSIKTRDGWTPIHAA
VDTGNVDSLKLLMYHRVPAPGNSLSAEEPKSGLFSLNGGESPPGSSKPVVPADLINHADK
EGWTAAHIAASKGFKNCLEILCRHGGLEPERRDKCNRTVHDVATDDCKHLLENLNALKIP
LRISVGEIQPSNDGSDDFECEHTICTLNIRKQTSWEDFSKAVSQALTNHFQAISSDGCWG
LEDGTLNNTTDSCIGLGTSSIQSIMLGSIPWSTGQSFSQSPWDFMKKKKVEQVTVLLSGP
QEGCLSSVTYTSMIPLQMLQNYLRLVEQYHNVIFHGPEGSLQDYIANQLALCMKHRQMAA
GFPCEIVRAEVDSGFSKEQLVDVFISNACLIPVKQFPVKKKIIVILENLEKSSLSELLGD
FLAPLENRSTESPCTFQKGNGTSECYYFHENCFLLGTLAKACLQGSDLLVQQHFRWVQLR
WDCEPSQGLLQRFLRRKAVSKFRGQLPAPCDPVCKIVDWVISVWRQLNSCLARLGTPEAL
LGPKYFLSCPVVPGHAQATVKWMSKLWNAIIAPRVQEAILSRAAMNKQPGARQTASKKHP
SQGQQAVVRAALSILLNKAILHGCPLPRTELDQQIADFKGGSFPLSIVSSYSKKKGESAA
WRKVNTSPRKKPGHFSSPMWNKPDLKHEGMRNKSVPHLNINRSSSLSKQQSLENDLSMTL
TLDHRLSLGSDDEADLVKELQSMCSSKSESDISKIADSREDLRTFDSSRTNPVTSAPVNL
RMPVPQKEASPLSSHQTTECSNSKSKTELGVSRVKSFLPVPRSKVAQCSQNTKRSSSSSS
NTRQLEINNNSKEENWNVDKHEHVEKRNK
NT seq 4950 nt   +upstreamnt  +downstreamnt
atggcgacggacagcgcgagctgcgagcccgacttgtcccgcgccccgggcgacgcggag
ggggccacggcggaggcggcgaaaaaggagtttgatgtggacaccctcagcaaatcagag
ctgcggatgctcctcagtgtgatggaaggtgaactagaagccagagacctcgtgattgag
gccctgcgggctcgcaggaaggaggtgttcatccaggaacgttatgggagatttaatcta
aacgaccctttcctggcactccagagagactatgaagcgggtgctggtgacaaagagaag
ccagtctgcaccaacccactctccattcttgaagccgtcatggcccactgcagaaaaatg
caagaaagaatgtccgcacagctggctgccgctgagagtaggcagaaaaagttggagatg
gaaaagctccagcttcaggcccttgaacaggagcacaagaagctggctgcccacctggag
gaagagaggggcaagaacaagcacgtggtcctgatgctggtgaaggagtgcaagcagctc
tcaggcaaagtcgtagaggaagctcagaagctggaggaagtcatggtgaaattggaggag
gaaaagaaaaagacaagtgagttagaagaccagctctccgctgagaaacagagaagcgct
ggaatggaagctcagctggagaaacagctctttgagtttgatacggaacgggagcagctg
cgggccaagctgacccgagaagaagcacacaccaccgacctcaaagaggagatagacaag
atgaagaaaatgatggagcaaatgaagaaaggcaacgatgggaagcccggactctccctc
ccccggaagacaaaagataagcgactggcttccatatctgtggcaacagaagggcctgtg
acaaggtctgttgcttgccagacagatgtagtgacagaaagcactgaccctgtgaagaaa
ttgcctttgtctgtacccataaaaccttccacagggagccccctagtttccacaaacaca
aaagggaatgtgggccccagtgccctgctgattagaccaggtattgatagacaagcttcc
cacagtgacttgggtccctctccacctactgccctaccgtcaagtgcaagtagaattgag
gaaaacggaccaagtgcaggcaatgcccctgacctatcaaacagcacaccctcaactcct
agtggaactgcccctgctgctgctcagacactaggtgcagcaccccagaaccattcacaa
gctcctcctgtgcacagtttacattcaccgtgtgccaacactcatccaggtctcaaccca
cgcatccaagcagctagatttagatttcagggcaatgcaaatgacccagaccagaatgga
aataacactcaaagtcctccctccagagatgtttctcctacgagtcgtgacaacctagta
gccaagcagctagctcggaatactgtgacccaagcgctgtccagatttaccagccctcaa
gcaggtgcttcttcaaggctgggagcatctccaggaggcgatgctggcacctgccctcca
gttggtcgaaccggtttaaagactccaggggcagcacgagttgacagaggaaatcctcct
cctatccctcccaaaaagccagggctctcccaaactccttctccaccacaccctcaactg
agggcctccaatgcaggggccaaagttgataacaaaattgtggcttcacctccctctaca
ttgccacaagggaccaaggtagtaaatgaggagaacgtccctaagtcatcctcccctcag
ctgccaccaaaaccatccatagatttaactgtggcatctgcaggctgtcccgtttcggcc
ctggccacgtctcaggtgggtgcctggcctgctgaaacccctggactgaaccaacccgca
tgtacagacagctcccttgtcattcccaccaccgttgcctttcgctcttccataaaccct
gttagtgcctcatcccgtagccccggtgcctcagacagcctcttggtaacagcatcaggc
tggtcaccctccctaacccctttgctaatgagtggtggtcctgcccccctggctggcagg
cccacccttcttcagcaagctgctgcccagggaaatgtcactctattatcaatgctgctt
aatgaagaaggactggacataaattactgctgtgaagatagccattctgccttgtattct
gctgctaagaatggacatacagactgtgtgcgattgctgctgaatgcagaagcccgcgtc
gacgctgctgataaaaatggcttcacacccttgtgcgttgcagccgctcagggacatttt
gaatgtatagaattactaactgcatacaatgccaacattaatcactctgctgctggagga
cagacacctctgtacctggcctgtaaaactggaaataaggaatgtatcaaactcctgctg
gaagctggcactgaccggagtataaaaaccagagatggctggacaccaattcatgcagcc
gtggacactggtaatgtggacagcctcaagctattgatgtaccatagagtgccagcccct
ggaaactctttgagtgcagaagagcccaagtcaggcttgttcagcttgaatggaggtgag
agccctccaggttcatctaagcctgtggttcctgcggacctcattaaccacgctgacaaa
gaaggctggactgctgcccatattgctgcttccaaaggtttcaagaactgcctagaaatc
ttgtgtaggcatggagggctagagccggaaaggagagacaagtgcaatcggactgtgcat
gatgttgccactgatgactgcaagcatttgctggagaatctgaatgctcttaaaataccc
ttaaggatttccgtgggtgaaattcaaccaagcaacgacggttctgacgactttgaatgt
gaacacacaatatgcactttaaatatccgcaaacagacatcatgggaagatttttcaaaa
gcagtgagtcaggctctgacaaatcacttccaagccatctcttctgatggatgttggggt
ctggaagatgggacacttaataacacgactgactcctgcatcggtcttggcaccagcagc
atacaatccatcatgctaggaagtattccgtggtcaactggtcagagcttttcccagtcc
ccgtgggacttcatgaagaagaagaaggtggagcaggtcacagtgctcttgtcaggtccc
caagaaggctgcctcagtagtgtgacttatacatccatgatcccacttcagatgctgcag
aactacctcaggctggttgagcaatatcataatgtcattttccatggcccagaaggaagc
ttgcaagactacatagcaaatcagcttgccctctgcatgaagcacagacagatggctgca
ggattcccctgtgaaatagtgagagctgaggtggattcaggtttctccaaggaacagcta
gtagacgtgttcatcagtaatgcctgtctgatcccagtaaagcagttccctgttaagaag
aaaataatcgtcatcttggaaaatttggaaaaatcatcattgtctgagttactgggggac
tttttggcacctttggagaatcgcagcactgaaagcccatgcactttccagaaaggaaat
ggaacatctgaatgctattatttccatgagaactgctttctgctgggaaccctcgccaag
gcttgtctccagggctctgacctgctggtgcagcaacacttccgctgggttcagctgcgc
tgggattgcgagcccagtcaaggactgcttcagaggttcctccgaagaaaagcagtcagc
aagttcagaggtcagctgcccgcaccctgtgatcctgtgtgtaaaattgtggactgggtt
atctctgtctggaggcagctcaactcctgcctggcccgcttgggtacaccggaagcactt
cttggacccaagtatttcctgtcttgtccagtagtcccgggacatgcccaagcaacagtg
aagtggatgtctaagctgtggaacgccatcattgctccccgagttcaagaagcaatactg
tcaagagccgccatgaacaaacaacctggtgctaggcagacagcttcgaagaagcaccct
agccaagggcagcaggctgtggtgagggctgctctcagcattctgcttaataaagccatt
ctgcatggctgtccccttcccaggacagagctggaccagcagatagcagacttcaaaggg
ggaagtttccctctgtcaatagtttcaagttatagcaagaagaaaggagagagtgcagcc
tggagaaaggtgaacaccagtcctcgcaagaaacctgggcacttctcctcacccatgtgg
aacaagccagacctgaagcatgaaggtatgagaaacaagagtgtaccacatctgaatatt
aacaggagctcctctctgtcaaagcaacagtccttagagaatgatctatccatgacattg
actttggaccacagactctctttgggttcagatgatgaggcagatctggtcaaagaactc
cagagtatgtgttccagcaaatctgagtctgatataagcaagattgctgattccagggaa
gacttaaggacatttgatagttcaagaaccaaccctgtgacttcagcacctgttaacctg
aggatgccagtgccacagaaggaagccagtcctctcagcagccatcaaactaccgaatgc
agcaacagtaaatccaagactgagttgggtgtctcaagagttaaatcttttcttcctgtt
cctagaagtaaagtcgcccagtgttcccagaacaccaaaagaagcagcagcagcagcagt
aatacaaggcaactagaaatcaataacaactccaaagaagagaattggaacgtagacaaa
cacgaacacgtagaaaaacgtaacaaatag

DBGET integrated database retrieval system