KEGG   Rattus norvegicus (rat): 286896Help
Entry
286896            CDS       T01003                                 

Gene name
Sgpl1, S1PL, Spgl1, spl
Definition
(RefSeq) sphingosine-1-phosphate lyase 1
  KO
K01634  sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    286896 (Sgpl1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    286896 (Sgpl1)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     286896 (Sgpl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SepSecS Beta_elim_lyase DUF374
Motif
Other DBs
NCBI-GeneID: 286896
NCBI-ProteinID: NP_775139
RGD: 628599
Ensembl: ENSRNOG00000000565
UniProt: Q8CHN6
Position
20q11
AA seq 568 aa AA seqDB search
MPSTDLLKLKDFEPYLEILEAYSTKAKNYVNGYCTKYEPWQLIAGSVLCTLLVVWVYELI
FQPESLWSRFKNKLFRLIRKMPFIGRKIQQQLTKAKKDLVKNMPFLKLDKDYVKTLPAQG
LSTAEVLERLKEYSSMDVFWQEGKASGAVYSGEPKLTELLVQAYGEFTWSNPLHPDIFPG
LRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPES
AHAAFDKAAHYFGMKIVRVAQKKNMEVDVRAMKRAISRNTAMLVCSAPQFPHGVIDPIPE
VAKLAVKYKIPFHVDACLGGFLIVFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAPKG
SSVVMYSNEKYRKYQFFVDADWQGGIYASPSIAGSRPGGIIAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKNIFILGDPQLSVIALGSNDFDIYRLSNMMSAKGWNFNYLQFP
RSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATIDRKMVAE
ISSVFLDSLYSTDPVTQGNQMNGSPKPR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtaccgaccttctcaagttgaaggacttcgagccttatttggagattttggaa
gcatattccacaaaagccaagaattacgtgaatgggtactgcaccaaatacgagccctgg
cagctcattgcggggagtgtcctgtgtactctgctggtagtctgggtatatgagcttatc
ttccagccagagagtttatggtctcggtttaaaaataaattatttaggcttataaggaag
atgccatttattggacgtaagatacaacagcagcttaccaaagccaagaaggatcttgtc
aagaacatgccattcctgaagttggacaaagattatgtgaaaaccctgcctgctcagggt
ctgagcacagctgaggttctggagagactcaaggagtacagctccatggatgtcttctgg
caagaagggaaagcctcaggagctgtgtacagtggggagccgaagctcaccgagctgctg
gtgcaggcttacggagaattcacgtggagcaatccactgcacccagatatcttccccgga
ctacggaagttagaggcagaaatcgtgaggatgacttgctccctcttcaatggggggcca
gactcctgtggatgtgtgacttctgggggaacagaaagcatcctaatggcctgcaaagca
tatcgggacttggccttagagaaggggatcaaaactccagaaattgtggctcctgagagt
gcccacgccgcattcgacaaagcagctcattatttcggaatgaagattgtacgcgttgcg
cagaaaaagaacatggaggtggatgtgcgggcaatgaaaagagccatctccaggaacaca
gccatgctggtctgttctgccccacagtttcctcatggtgtgatagatcctatccccgaa
gtggccaagctggctgtcaaatataaaatcccattccatgtggatgcttgtcttgggggc
ttcctcattgtcttcatggagaaagcagggtacccactggagaaaccatttgatttccgg
gtgaaaggtgtgaccagcatttcagcagatactcataagtacggctatgctcccaaaggt
tcatcagtggtgatgtactctaacgagaagtacaggaagtaccagttctttgttgatgca
gattggcaaggtggcatctacgcatctccaagcatagctggctcacggcctggtggcatc
attgcagcctgttgggccgccttgatgcactttggtgagaacggctatgttgaagctacc
aaacagatcatcaaaactgctcgcttcctcaagtcagaactggaaaacatcaaaaacatc
ttcattttgggggatcctcaattgtcagttattgctctgggctccaacgattttgacatc
taccgactatctaatatgatgtctgctaaggggtggaattttaactacttgcagttccca
agaagcattcatttctgcattacgttagtacatactcggaagcgagtggcaatccagttc
ctaaaggatatccgggaatcggtcacacaaatcatgaagaatcctaaagctaagaccaca
ggaatgggtgccatctatggcatggcccaggcaaccattgacaggaagatggttgcagaa
atatcctccgtcttcttggacagcctttatagtacagaccctgtgactcagggtaaccag
atgaacggttctccaaagccccgctga

DBGET integrated database retrieval system