KEGG   Rattus norvegicus (rat): 286975
Entry
286975            CDS       T01003                                 

Gene name
Skap1
Definition
(RefSeq) src kinase-associated phosphoprotein 1
  KO
K17699  src kinase associated phosphoprotein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    286975 (Skap1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    286975 (Skap1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   286975 (Skap1)
SSDB
Motif
Pfam: PH SH3_1 SH3_9 SH3_2 PH_9 PH_11
Other DBs
NCBI-GeneID: 286975
NCBI-ProteinID: NP_775433
RGD: 708436
Ensembl: ENSRNOG00000023881
UniProt: Q4V7G1
Position
10
AA seq 354 aa
MQAIALPEEICWLLEDAEDFLAEGLQNENLSPGAQDQRDHILRGFQQIKSRYCWDFQPQG
DDLGQDGSDENLSGTHGPALASDASFWSDYQEEGIDDIIRGAQELDNVIKQGYLEKKSKD
HSFFGSEWQKRWCVISRGLFLYYANEKSKQPKGTFLIKGYNVRMAPHLRKDSKKDSCFEL
TSQDRRSYEFTAFSPAEARDWVDQISFLLKDLSSLTIPFEEEEEEEEEDKEQEEMYNDID
GFDSARSGSQGRAMALPEPLDKEEDVYEVLPDEDDLEEDACGAHRRRVDYADYYQGLWDC
HGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSIIGIVPKDYLTTAFEMEGR
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcaggccatcgccctcccggaggagatctgttggctcctggaagatgctgaagacttt
ctggcggaaggcttgcagaatgagaaccttagtcctggggcacaggatcagagagaccac
attctccggggtttccagcaaatcaaatccaggtactgttgggattttcagccccaagga
gacgaccttggccaagacggctctgatgaaaatctgagtgggacacacggcccagccctc
gcatcagatgcatccttttggtcagattatcaggaggagggaatagacgacatcatcaga
ggggctcaagagctggataacgtcatcaaacaaggatacctggagaagaaaagcaaagat
catagcttctttgggtcggagtggcagaagcgatggtgtgttatcagcagagggctcttc
ctctactatgctaatgagaaaagcaagcagcccaaaggaaccttcctcattaagggatac
aacgtccggatggcccctcacctgcggaaagactccaagaaagactcctgctttgaactg
acctcccaggataggcgcagctatgagttcacagcttttagtccagctgaagccagagac
tgggtggatcaaataagtttcttgttaaaagatcttagctccttgaccattcccttcgaa
gaggaggaggaggaggaagaggaagacaaagaacaggaagaaatgtacaatgacattgat
ggctttgactccgcaaggtccggctcccagggcagagccatggccttgcctgagcctctg
gacaaagaggaggacgtttacgaagtcctaccagatgaagatgatctagaagaggatgca
tgtggcgctcatcggcggcgagtggactatgccgattattaccagggcctctgggattgc
catggtgaccagccagatgaactgtccttccaacgaggtgacctcatccgcattctgagc
aaggagtacaacatgtacggctggtgggtaggagaactgaacagcatcattgggattgtt
ccaaaggactacctcaccaccgcctttgaaatggaaggaagatga

DBGET integrated database retrieval system