KEGG   Rattus norvegicus (rat): 287418
Entry
287418            CDS       T01003                                 

Gene name
Arhgef15, E5
Definition
(RefSeq) Rho guanine nucleotide exchange factor 15
  KO
K20687  Rho guanine nucleotide exchange factor 15
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287418 (Arhgef15)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    287418 (Arhgef15)
SSDB
Motif
Pfam: RhoGEF
Other DBs
NCBI-GeneID: 287418
NCBI-ProteinID: NP_001099259
RGD: 1306961
Ensembl: ENSRNOG00000004566
UniProt: D3ZPJ8
Position
10q24
AA seq 670 aa
MSAQSLPAATPPTLKPPRIIRPRPPSRHRAPHSPGPPHNGSSPKALPQISNDASASVCTS
IFWEPPTGSLKPPALLPPSVSRASLDSQTSPDSPSSTPSPSPVSRRSISPEPAPCSPVPP
PKPSGSSRTPLPLGPVPLQDGSASAPGTVRRLAGKFEWGAEGKAQSADSLERCSQGSTDV
NGEKETLQVGLSGNGSQENGTPAKPGLELRWVPVGSSDDILRAPCRASPLRASRSRINPP
VISHPPVVLTSYRSTAERKLLPPLKPPKPTRVRQDTSTSGELPQPDLELPSEDGIQAAPK
AWEGDRPEEAPQNAPPPVALEGREEEGLEGLKELQWELPLQDEPLYQTYRAAVLSEELWG
VGEDGGPSPANPGEAPTFSRLPGPRNTLWQELPAVRGSGLLESLSPQERRMQESLFEVVT
SEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQSVSERFLGTLLSRVRSSP
HISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQSLPKCERL
PLPSFLLLPFQRITRLRMLLQNILSQTEEGSSRQENAQKALGAVSKIIERCSAEVGRMKQ
TEELIRLTQRLRFHKVKVGLRGFLELSLPNWCVKSQENMKGESIFASIRSSLRLQDPLQT
LLTPLNLRAA
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgtcagctcagtctctccctgcagcaacgccccctaccctgaagccccctcggatcatc
cgcccccgacccccatctcggcatagggctccacactccccggggcctccgcacaatggc
tcctctccgaaagcacttcctcaaatatccaatgatgcatcagcctcagtgtgcacctcc
atcttctgggaaccccccacgggttccctgaagccccctgctcttctgcctccctcagtt
tctagagccagcctggactctcagacttcccctgactcaccttccagcacaccgagtccc
agcccagtgtcccggcgctccatctccccagaaccagctccctgctctccggtacccccg
cccaagccctctggatcttcccgaacacctttgcccttgggccccgtgcctctccaggat
ggctctgcctcagcccctggcacggttcgcagactggccggcaagtttgaatggggagct
gaaggcaaggcccagtcggcagactccctggaacggtgctcccaagggagcacggatgtg
aatggggagaaagagactctccaagtcggcctttcggggaatgggtcccaggagaatggc
actcccgcaaaacccggcctggagctccgatgggtgcctgtgggaagttctgacgacatc
ctcagggctccctgccgggcatctccactccgagcctcccgctcccgtatcaaccctcca
gtcatcagtcaccctccagttgtgctcacatcctatcgctccactgcggagcgcaaactc
ctacctcccctcaagcctcccaagccaactagagtcagacaggacaccagcacctctggg
gagcttccacagccggacctggaactgccttcagaagatggaatccaagcagctccaaag
gcctgggaaggggacagacctgaagaagctcctcagaacgctcctcctccggtagccttg
gagggaagggaggaggaagggctggaggggctgaaggagctgcagtgggagctgcccctg
caggacgaacctttataccagacttaccgagcagctgtgctgtcagaggagctgtggggt
gtgggtgaggatgggggtccctctccagctaatcctggagaagctcccaccttctccagg
ctccctggacctcgaaacactctgtggcaggagctcccggctgtgcgaggcagtggtctc
ttagagagtctaagcccccaggaaaggcgcatgcaggagagcctgtttgaggtggtgaca
tcagaggcctcctacctgcgctccctgaggctgctgaccgacaccttcgtcctgagccag
gctctccgggacaccctcactcctcgggatcatcatacgctcttctccaatgtgcagaga
gtccagagtgtcagtgagcggtttctaggaacactgctgtcacgtgttcgttcctcccca
cacatctctgacctgtgtgacgtggtgcacgcccacgcagttggtcctttctccgtgtat
gtggattacgttcggaaccagcagtatcaagaggagacgtatagccgccttatggataca
aacgtgcgattctctgcggagctgcgcaggctacagagcctccccaaatgcgagcggctc
ccactgccatctttcctgctactgcccttccagcgcatcacccgcctccggatgttgtta
cagaatatcctaagccagacagaggaggggtccagtcgtcaggagaatgcccagaaggcc
ttgggtgctgtgagcaagatcattgagcgctgcagcgctgaggtggggcgcatgaagcag
actgaagagctcatccgactcacccaaaggttgcgctttcacaaagtcaaggttggctta
aggggcttcctggagctttccctgcccaactggtgtgtgaagtcacaggagaacatgaaa
ggagaaagcatcttcgccagcatcagaagctccttgaggctgcaggaccctcttcagaca
ctcctgacacccctcaaccttagggcagcctag

DBGET integrated database retrieval system