KEGG   Rattus norvegicus (rat): 287433
Entry
287433            CDS       T01003                                 

Gene name
Fxr2, Fxr2h
Definition
(RefSeq) FMR1 autosomal homolog 2
  KO
K15516  fragile X mental retardation protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    287433 (Fxr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    287433 (Fxr2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     287433 (Fxr2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     287433 (Fxr2)
   mRNA cycle factors
    Stress granule specific factors
     287433 (Fxr2)
SSDB
Motif
Pfam: FXMRP1_C_core FXR_C1 KH_9 Tudor_FRX1 KH_1 Agenet KH_2 SH3_2 NdhS DUF5348 PBP_N
Other DBs
NCBI-GeneID: 287433
NCBI-ProteinID: NP_001094117
RGD: 1307011
Ensembl: ENSRNOG00000011876
UniProt: B1H2A6
Position
10q24
AA seq 675 aa
MGGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLP
PPADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLE
RLRPVNPNPLATKGSFFKVTMAVPEDLREACSNENVHKEFKKALGANCIFLNITDSELFI
LSTTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLM
GLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSEDSVQVPR
NLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQAL
LEYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGGSGGGSDKAGYTTDESSSSS
LHTTRTYGGSYGGRGRGRRTGGPAYGPSSDPSTASETESEKREESNRAGPGDRDPPSRGE
ESRRRPIGGRGRGPPPVPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPVDSEPGEP
PPASARRRRSRRRRTDEDRTVMDGGLESDGPNVTENGLEDESRPQRRNRSRRRRNRGNRT
DGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSRLPKGPSENGE
LSAPLELGSLVNGVS
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgggcggcctggcctctgggggggatgtggagccgggactgcccgtcgaggtgcggggc
tccaacggggccttctacaagggctttgttaaggatgtccatgaagactctgtcactatc
ttctttgaaaacaactggcagagtgagagacagattccctttggggatgtccgactacca
cctccagctgactacaataaggagatcacagaaggagatgaagtagaggtctattcgaga
gccaatgaacaggaaccttgtggttggtggctggcccgggtgcggatgatgaagggagat
ttctatgtcattgagtatgctgcctgtgatgctacctacaatgagattgtcactctggag
cgacttcggccagtcaatcccaatccccttgcaaccaaaggcagcttcttcaaggttacc
atggctgtgcctgaggatcttagagaggcctgctccaatgaaaatgtccataaagagttc
aagaaagcactgggagccaactgcatcttcctcaacatcacagacagtgagctcttcatt
ctgtcaaccacagaagcccctgtgaagagggcatctttgctgggtgacatgcatttccga
agccttcgtaccaaattgctgctcatgtcccgcaatgaagaagctactaagcacctagag
acaagtaagcaattggcagcagcattccaagaggagtttacagttcgagaggacctgatg
ggtctggcaattgggactcacggtgccaacatccagcaggctcgaaaagtgccaggagtg
actgccattgagttgggtgaagagacctgcactttccgaatctatggggagacgccagag
gcatgcagacaggctcgaagctaccttgaattttctgaggactctgtacaagtgcccagg
aacctggttggcaaagtgattggaaagaacgggaaagtgattcaggagatcgtggataag
tctggtgtggtgcgggttcgtgtggaaggtgataacgacaagaagaaccccagggaggag
ggaatggttcccttcatatttgttggcacccgagagaatatcagcaatgcccaggcactg
ctagagtatcacctctcctacctgcaggaggttgaacagcttcgcttggagagactgcaa
attgatgaacagcttcggcagattgggctaggctttcgccctcctgggagtggacggggt
ggcagtggtggtggcagtgacaaggcgggctataccacagacgagagctcctcctcttcc
ctgcacacgaccagaacctatgggggcagctatgggggccggggccggggccggaggact
ggtggtcctgcctatggccccagctcagacccctccacagcttctgagacagagtcagaa
aagagagaggaatctaatcgagcaggacctggtgacagagatcccccaagccgtggagaa
gaaagcaggaggcggccaattgggggccggggaaggggacccccacctgttccccggcct
acctcaagatacaactcatcatctattagctcagtgctaaaggatccagacagcaaccct
tacagcctattggacacatctgaaccagagcctccagttgattcagaacctggtgaacct
cctccagcaagtgcccgtcgtcgccgttcccgccgccgtcgtactgatgaagacaggact
gtcatggacggaggcctggagtctgacggtcctaacgtgacagagaatggcctggaagat
gaatcaagaccccagagacgtaatcgcagccgccgccgccgtaatcgtggtaaccggact
gatgggtccatcagcggagaccgccaaccagtgactgtggctgactacatctcacgggca
gagtctcagagccgccagcggccacctctggagcgcacaaaaccctcagaggattctctt
tcaggacagaagggtgactctgtcagcaggcttcccaagggcccctcagagaatggggag
ctctctgccccattggagttgggtagtttggtgaatggggtttcataa

DBGET integrated database retrieval system