KEGG   Rattus norvegicus (rat): 287679
Entry
287679            CDS       T01003                                 

Gene name
Krt40, Ka36
Definition
(RefSeq) keratin 40
  KO
K07604  type I keratin, acidic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    287679 (Krt40)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    287679 (Krt40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    287679 (Krt40)
   04147 Exosome [BR:rno04147]
    287679 (Krt40)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     287679 (Krt40)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   287679 (Krt40)
  Exosomal proteins of other body fluids (saliva and urine)
   287679 (Krt40)
  Exosomal proteins of colorectal cancer cells
   287679 (Krt40)
  Exosomal proteins of melanoma cells
   287679 (Krt40)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 UPF0242 UFD1 UPF0184 Phage_GP20
Other DBs
NCBI-GeneID: 287679
NCBI-ProteinID: NP_001008821
RGD: 1359145
Ensembl: ENSRNOG00000013896
Vega: OTTRNOG00000001557
UniProt: Q6IFW2
Position
10q31
AA seq 431 aa
MASEGSPDCCSSEPYAGASSCTTASFCPTSTTYLPSTCATSRCQTPSFLCRAHLPAGCLS
PCYLTGGCNSPCLVGNCAWCEEGTFNSNEKETMQFLNDRLASYLERVRSLEENNAELECR
IREQCEPDATPVCPDYQRYFDTIEELQQKILCTKAENSRLAVQVDNCKLAADDFRSKYES
ELSLRQLVENDISGLRGILGELTLCKSDLEAHVESLKDDLLCLKKDHEEEVNLLREQLGD
RLNVELDTAPTVDLNKVLDEMRCQYERVLANNRRDAEEWFAAQTEELNQQQMSSAEQLQG
CQTEMLELKRTANTLEIELQAQQTLTESLECTVAETEAQYSTQLAQMQCLIDSVEHQLAE
IRCDLERQNQEYKVLLDTKARLECEINTYRGLLEKEDSRLPCNPGSTASISNSACEPCSA
YVICTVENCCA
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggcttccgaaggctcccctgactgctgctcttctgagccctatgcaggggcatcgagc
tgcacaactgcctcattctgccccaccagcacaacttaccttcccagcacctgcgccaca
tccagatgtcaaaccccgagcttcctctgcagggctcacctcccggccggttgcctctca
ccgtgctacttgactggcggttgtaacagtccttgcctggtggggaactgtgcatggtgt
gaagaagggacgttcaacagtaatgagaaggagaccatgcagttcctgaatgacagattg
gccagctacctagagcgggtgagaagcctggaagagaacaatgcagagctggagtgcagg
atccgagagcaatgtgagcccgatgccacaccggtctgcccggattatcagcggtacttt
gacaccattgaagagctacaacaaaagatattgtgcacgaaggcagagaattctagactt
gccgtgcaggtggacaactgcaaactggctgccgatgattttaggtcaaagtatgagagc
gaactgtccctgcgccagctggtagagaatgacatcagtggtcttcgtgggatcctgggt
gaactgaccctgtgcaagtcagatctggaggcccatgtggagtctctgaaagatgatcta
ctttgccttaagaaagaccatgaagaggaggtcaacttgcttcgtgagcagcttggagat
cgactcaatgtggagctggacactgcccccactgtggacctcaacaaggtcctggatgag
atgcggtgtcaatatgagagggtgctggccaacaaccgcagggatgcggaggagtggttc
gctgctcagacagaagagctgaaccagcagcagatgtccagtgcagagcagctgcagggc
tgccagactgagatgctggagttgaagcgtacagccaacactctggaaattgagctccag
gcacagcaaaccctgacagagtctctggagtgtactgtggcagaaactgaagcccagtac
agcacacaactggcccaaatgcagtgcctaattgatagtgtggagcaccagctggctgag
atccgctgtgacctggagcgtcagaaccaggagtacaaggtgctactggacaccaaggcc
cggctggagtgtgagatcaacacatacaggggcctgctggagaaagaggacagcagactc
ccctgcaatccaggctccacagcctccatatcaaacagcgcatgtgagccgtgttcagcc
tacgtgatttgcacggttgaaaactgctgtgcatga

DBGET integrated database retrieval system