KEGG   Rattus norvegicus (rat): 287706
Entry
287706            CDS       T01003                                 

Gene name
Klhl11
Definition
(RefSeq) kelch-like family member 11
  KO
K10449  kelch-like protein 11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    287706 (Klhl11)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     287706 (Klhl11)
SSDB
Motif
Pfam: BACK BTB Kelch_6 Kelch_1 Kelch_4 Kelch_2 Kelch_3 DUF3342
Other DBs
NCBI-GeneID: 287706
NCBI-ProteinID: NP_001099308
RGD: 1306673
Ensembl: ENSRNOG00000016921
UniProt: D3ZPJ1
Position
10q31
AA seq 709 aa
MAAAVAAAAAAAAAAASFQVLEMESMETAVAGSASLAAEVRGSGTVDFVTGAGISTLVDT
GGGDPGPEAEDFECSTHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAAT
EYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLEL
ADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFYKVIQDE
EFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKP
TYLTRHVKPERLVANNEVCVKLVAEAVERHALRAENIQSGTLQHPTSQVSLLPRYGQNMD
VIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAITESYVYVAGSMEPGF
AKTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELD
KWHNLESAPKILRDVKALAVEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVES
LPLIDNYCFFQMSVVNSNFYQTASCCPKSYSLENEEAVRKIAGQVSDEILESLPPEVLSI
EGAAICYYRDDVFIIGGWKNSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHV
RIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcggcggctgtggcagcggcggctgcggctgcggccgcggcagcatcttttcaagtg
ctggagatggagagcatggagactgccgtcgctggttccgcgagtctggccgccgaggtc
cgaggcagtggcacggtagactttgtgaccggggctgggatctctacccttgtcgacacg
ggcgggggcgatccgggcccagaggccgaggacttcgagtgcagtactcactgctccgag
ttgtcctggcggcagaacgagcagcggcgtcaaggtctgttctgcgacatcaccctgtgc
ttcggtggggccggaggtcgcgagttccgagcccaccgctcggtgctggccgccgccacc
gagtacttcacgcccttgctctcaggccagttttcggaatcgcggtcaggccgggtagag
atgcgcaagtggagctcggagccgggacccgaacctgacacggtagaagccgttatcgag
tacatgtacaccgggcgcatccgagtgagcaccggcagcgtgcacgaggtgttggagctg
gcggacagattcttattaattcgtttaaaagaattctgtggagaatttctcaagaaaaaa
cttcatctctcaaattgtgtggccattcacagcttagcccacatgtataccctgagccag
cttgctctgaaagctgcagatatgattcggagaaatttctataaagtcattcaggacgag
gaattttacactttacctttccatctcattcgagactggctttcagacctggagattact
gtggattctgaggaggttctttttgaaacggttttgaagtgggttcagagaaatgccgaa
gagagagagagatactttgaagaactttttaaattactcaggttgtcccagatgaaaccc
acctaccttacgcggcatgtcaaaccagagcggctggtggccaataatgaagtttgtgtc
aagctggtggctgaagcagtggagaggcatgcgctcagagcagagaatatacagtctggc
acactgcaacatcccacttcgcaagtctcactgttacctcgctatggacaaaacatggat
gtgatcatggtcatcggaggtgtgtcagaaggaggagactatttaagtgaatgtgtagga
tatttcgttgatgaggatagatgggtaaatctgccccacattcataatcaccttgatgga
catgccgttgcaattacagaatcgtatgtgtatgttgctggctccatggaaccagggttt
gctaaaactgtggaaagatacaacccaaacctgaatacttgggaacacgtttgtagtctg
atgaccagaaagcactcttttgggctaacagaagtcaaagggaagctgtatagcattgga
ggacatggaaattttagccctggctttaaagatgtgactgtttacaatcctgagcttgat
aagtggcacaatttagagtcagcaccaaagattcttcgagatgtcaaagcactagccgtt
gaggaccggtttgtgtacattgctgcccgtacgcctgtggaccgggacaccgaggatgga
ctgaaggctgtaattacttgctatgatacagagactcgacagtggcaagatgtggaatct
ttgccgcttattgacaattactgttttttccagatgtctgtggtcaattcaaacttctat
cagacagcatcatgctgtcccaagagttactctttagaaaatgaagaggcagtaaggaag
attgctggtcaggtgtctgatgagatcctggaaagcctgcctccagaagtcctgagcatc
gaaggagcagccatttgctactacagagatgatgtcttcattattgggggctggaagaac
agcgatgacattgacaagcagtatcggaaggaggcctaccggtactgtgctgagagaaag
aggtggatgctcctccctccaatgcctcagccccgttgcagggccactgcttgccacgtc
aggatcccctaccggtacttgcacggcacacagagataccccatgcctcaaaacttaatg
tggcagaaggaccgcatccgacagatgcaagagatacatcggcatgccctgaacatgcgc
agagtgccaagttcccagattgaatgctga

DBGET integrated database retrieval system