KEGG   Rattus norvegicus (rat): 287722
Entry
287722            CDS       T01003                                 

Gene name
Tmem106a, RGD1309043
Definition
(RefSeq) transmembrane protein 106A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF1356 Anti-TRAP
Other DBs
NCBI-GeneID: 287722
NCBI-ProteinID: NP_001020138
RGD: 1309043
Ensembl: ENSRNOG00000023628
UniProt: Q5BK83
Position
10q31
AA seq 261 aa
MGKAFSQLTSQKDEDKSILPDNPAMASKAANYFSTGNRKPSHSCVPCEKAASTSFVTCPT
CQGNGEIPQELEKQLVALIPYGDQRLKPRRTKLSVFLAVTICLLIFSLTIFFLYPRNIVV
HPVGLNSSTVAFDETHVQLNMTNVLNITNSNFYPVTVTQLTAEVLHQTSVVGQVTSSLRL
HIGPLASKQMPYEVASRILDENTYKICTWPKIRVHHILVNIQGALTCSYLTHPQQLPFES
FEYVDCRENMSMPHLELPRPA
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggtaaggcattctcccagctcacctctcagaaggatgaggacaagtctatcctacct
gataaccccgccatggccagcaaggctgccaactacttcagcactggtaacagaaaacca
tcacactcctgtgtgccttgtgaaaaggctgcgagtaccagctttgtgacttgtcctacc
tgccaaggcaatggggagatcccccaagagctagagaagcagctggtggccctcatccct
tatggagaccaaaggctgaagcccagacgcacgaagctctctgtgttcctggccgtgacc
atctgcctgctgattttctccctcaccatctttttcctgtatccacggaacattgttgtg
catcctgtaggcctcaactcctctacagtcgccttcgatgaaactcatgtacagctcaac
atgacgaatgtcctgaacatcaccaacagcaacttctatcccgtcacagtgacacagctg
acggccgaggtgctccaccagacctctgtggtaggccaggttaccagcagtctccgcctg
cacattggccctttagccagtaagcagatgccttacgaagttgccagcaggattttggat
gaaaacacatacaaaatctgtacatggccgaaaatcagagtccaccatatccttgtgaat
atccagggtgctctgacctgctcctacctgacccatccacaacagctacccttcgagagc
ttcgaatatgtggactgcagagaaaacatgtcaatgccccatctggagctccctcgccca
gcctga

DBGET integrated database retrieval system