KEGG   Rattus norvegicus (rat): 287765
Entry
287765            CDS       T01003                                 

Gene name
Ddx5
Definition
(RefSeq) probable ATP-dependent RNA helicase DDX5
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    287765 (Ddx5)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    287765 (Ddx5)
   05205 Proteoglycans in cancer
    287765 (Ddx5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    287765 (Ddx5)
   03009 Ribosome biogenesis [BR:rno03009]
    287765 (Ddx5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     287765 (Ddx5)
Spliceosome [BR:rno03041]
 Complex A
  U1 snRNP components
   U1 related factors
    287765 (Ddx5)
 Complex B
    287765 (Ddx5)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    287765 (Ddx5)
SSDB
Motif
Pfam: DEAD Helicase_C P68HR ResIII ERCC3_RAD25_C Helicase_C_2
Other DBs
NCBI-GeneID: 287765
NCBI-ProteinID: NP_001007614
RGD: 619906
Ensembl: ENSRNOG00000030680
UniProt: Q6AYI1
Position
10
AA seq 615 aa
MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAI
QAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLR
RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHI
NIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGS
GRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANY
TNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVANMHNGMNQQAYAYPATAA
AAPMIGYPMPTGYSQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgtcgagttattctagtgaccgagaccgcggccgggatcgagggtttggtgcacctcga
tttggagggagtagaacaggacccctatctggaaagaagtttggaaatcctggggagaaa
ctagttaaaaagaagtggaatcttgatgagctgcccaaatttgagaagaatttttatcag
gaacaccctgatttggcaaggcgcaccgcacaagaggtagatacgtacagaagaagcaag
gaaattacagtcagaggtcacaactgtccaaaacctgttctgaatttttatgaagcaaac
tttcctgcaaatgtcatggatgtgattgcaaggcagaacttcactgaacccactgctatc
caagctcagggctggccagttgctctcagtggattggatatggttggagtagctcagact
ggatctgggaaaacattatcttatttgctgcctgccattgtacacataaaccaccagcca
ttcttagagagaggtgatgggcctatttgcttggtgctggcaccaactcgagaactggca
cagcaggtgcagcaggtcgctgctgaatattgtagagcttgtcgcttgaagtctacttgc
atctatggtggtgctcccaaaggaccgcagattcgtgatttggagagaggtgtggaaatc
tgtattgcaacacctggaagactgattgactttttagagtgtgggaaaaccaatctgaga
agaacaacttaccttgtccttgatgaagctgataggatgcttgatatgggctttgaaccc
caaataaggaaaattgtggatcaaataagacctgataggcaaacactaatgtggagtgca
acttggccaaaagaagtaagacagcttgctgaagatttcctgaaagactatattcatatc
aatattggtgcactggaactgagtgcaaaccataacattcttcagattgtggatgtgtgt
catgatgtcgaaaaggatgaaaaacttattcgtctgatggaagagatcatgagtgagaag
gagaataaaaccattgtttttgttgaaaccaaaagaagatgtgatgaacttaccagaaaa
atgaggagagatgggtggcctgccatgggcatccatggtgacaagagtcaacaggaacga
gactgggttctaaatgaattcaaacatggaaaagctcctattctgattgctaccgatgtg
gcctccagagggctagatgtggaagatgtgaaatttgtcatcaattatgactaccctaac
tcctcagaggattatattcatcgaattggaagaactgctcgcagtaccaaaacaggcaca
gcatacactttctttactcccaataacataaagcaagtgagcgacctcatctctgtgctt
cgggaagccaatcaagcaattaatcccaagttgcttcagttggtcgaagacagaggttca
ggtcgttccaggggtagaggaggcatgaaggatgatcgtcgtgacagatactctgcaggg
aaaaggggtggatttaatacctttagagacagggaaaactatgacagaggctactctagt
ctgcttaagagagattttggggctaaaactcagaatggtgtttacagtgctgcaaattac
accaatgggagctttggaagtaattttgtatctgctggcatacagaccagttttaggact
ggtaacccaacagggacttaccagaacggttatgatagcactcagcaatatggaagtaat
gttgcaaatatgcacaatgggatgaaccaacaggcatatgcatatcctgctaccgcagct
gctgcgcctatgattggctatccaatgccaacagggtattctcaataa

DBGET integrated database retrieval system