KEGG   Rattus norvegicus (rat): 288077
Entry
288077            CDS       T01003                                 

Gene name
Hcls1
Definition
(RefSeq) hematopoietic cell specific Lyn substrate 1
  KO
K06106  cortactin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno05100  Bacterial invasion of epithelial cells
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    288077 (Hcls1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    288077 (Hcls1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    288077 (Hcls1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288077 (Hcls1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    288077 (Hcls1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    288077 (Hcls1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    288077 (Hcls1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     288077 (Hcls1)
SSDB
Motif
Pfam: HS1_rep SH3_1 SH3_9 SH3_2 TPX2 DUF4100
Other DBs
NCBI-GeneID: 288077
NCBI-ProteinID: NP_001011898
RGD: 1304754
Ensembl: ENSRNOG00000038881
UniProt: Q68FX4
Position
11q21
AA seq 476 aa
MWKSVVGHNVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDILKKRELESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
GGKYGVERDRADKSAVGFDYKGEVEKHASQKDYSHGFGGRYGVEKDKRDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKA
KFESMAEEKRKREEEEKAQQMARQQQERKAMVKMSREAQQPSVPVDEPAAPAPLPKKISS
EVWPPAESHLPPQSEPVGGRREYPVPSLPTRQPPPQNPLEDNEEPPALPPRTPEGLQVVE
EPVYEAAPEPEPEPEPDYEDVGELDRPDEEAEGDYEDVLEPEDTPSLSYQAGHSAGAGGA
GISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtggaagtctgtagtggggcacaatgtatcggtttccgtggagacccagggtgatgac
tgggacacagaccctgactttgtgaatgacatctctgagaaggaacaacggtggggagcc
aagaccattgagggctctggacgcacagagcatatcaacatccaccagctgaggaacaaa
gtgtccgaggagcatgacattctcaagaagagagagctggagtcggggcctaaagcctcc
catggctatgggggtcggtttggagtggaaagagaccggatggacaagagtgccgtgggc
cacgagtatgttgctgaagtggagaaacactcgtctcagactgatgccgccaaaggcttt
gggggcaaatatggagttgagagggaccgggcagacaagtcagcggtgggctttgactac
aaaggagaggtggagaagcacgcatctcagaaagattactctcatggctttggtggccgc
tacggggtagagaaggataaacgggacaaagcagctctgggatatgactacaagggagag
acggagaagcacgagtctcagcgagattatgccaagggctttggtggtcaatatggaatc
cagaaagacagagtggataagagtgctgttggcttcaatgaaatggaggccccaaccacg
gcatataagaagacaacacccatagaagctgcttccagtggtgcccgtgggctgaaggca
aaattcgagtccatggctgaggagaagaggaagcgagaagaagaagagaaggcacaacag
atggccaggcagcagcaagaacgaaaggctatggtgaagatgagccgtgaagctcagcag
ccatccgtgcctgtggacgagcccgcagcaccagccccgttgcccaagaagatctcctca
gaggtctggcctccagcagagagtcacctaccaccacagtccgagcccgtgggaggcaga
agagaataccctgtgccctccctgcccacgagacagcctccacctcagaatcccctcgag
gacaatgaggagcccccagctctgccccctaggactccagaaggcctccaggtggtagaa
gagccagtgtacgaagcagcacccgagcccgagcctgagcccgagcctgactatgaggat
gttggagagttagatcggccggatgaggaagcagagggagactatgaggatgtgctggag
cccgaggacaccccttctctatcctaccaggctggacactcagctggggctggcggtgca
gggatctctgctgtagccctttatgattaccaaggagagggaagtgatgagctgtccttt
gacccagatgatgtcatcactgacattgagatggttgatgaaggctggtggcggggccga
tgtcatggccactttggactctttcctgcaaactatgtcaagctcctctga

DBGET integrated database retrieval system