KEGG   Rattus norvegicus (rat): 288512Help
Entry
288512            CDS       T01003                                 

Gene name
Elfn1, Ppp1r28, RGD1308787
Definition
(RefSeq) extracellular leucine-rich repeat and fibronectin type III domain containing 1
  KO
K17567  protein phosphatase 1 regulatory subunit 28
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    288512 (Elfn1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     288512 (Elfn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 fn3_2
Motif
Other DBs
NCBI-GeneID: 288512
NCBI-ProteinID: NP_001099383
RGD: 1308787
Ensembl: ENSRNOG00000022767
UniProt: D3ZZ44
Position
12q11
AA seq 829 aa AA seqDB search
MAGHGWGAPWVLVAAATLLHACGLAQGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINN
TIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQLGYNRL
RNLTEGMLRGLSKLEYLYLQANLIEVVMASAFWECPNIVNIDLSMNRIQQLGSGTFAGLT
KLSVCEIYSNPFYCSCELLGFLRWLAAFTNATQTHDRVQCESPPVYAGYFLLGQGRHGHQ
RSILSKLQSVCTEGSYTAEVLGPPRPVPGRSQPGHSPPPPPPEPSDMPCADDECFSGDGT
TPLVVLTTLVPQTEARPSMKVKQLTQNSATIMVQLPSPFNRMYTLEQYNNSKSFTVSKLT
QPQEEIRLTNLYTLTNYTYCVVSTSSGTHHNHTCLTICLPKPPSPPGPVPSPSTATHYIM
TILGCLFGMVLVLGAVYYCLRKRRRQEEKHKKAVAAAAGSLKKTIIELKYGPEIEAPGLA
PLTQGPLLGPEAVTRIPYLPAATSDVEQYKLVESGETPKATKGNYIEVRTGEPPERRGCE
LSRPAPETQSSVAEISTIAKEVDRVNQIINNCIDALKSESTSFQGAKSGAVSAAEPQLVL
LSEPLASKHSFLSPVYKDAFGHGGLQRHHSVEAATGPPRASTSSSGSARSPRTFRAETAG
AHKAPATETKYIEKSSPVPETILTVTPAATVLRAEADKSRQYGEHRHSYPGSHPAEPPAP
PPPPPTHEGLGGRKASILEPLTRPRPRDLVYSQLSPQYHNLSYSSSPEYTCRASPSIWER
LRLSRRRHKDDAEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcacgggtggggtgcaccgtgggtacttgtggcagccgccacattactgcac
gcttgtgggctggcccaaggtgactgctggctgattgagggtgacaagggcttcgtgtgg
ctggccatctgcagtcagaaccagccgccctatgaggccatcccccagcagatcaacaac
accatcgtggacctgcggcttaacgagaaccgcatccgcagcgtgcagtacgcgtccctc
agccgcttcgggaacctcacatacctcaacctcaccaagaatgagataggctacatcgag
gacggggccttctctggccagttcaacctccaggtgctgcagctgggttacaaccggctg
cgcaaccttacggagggcatgctgaggggcctgagcaagctcgagtacctgtatctgcag
gccaacctcatcgaggtggtgatggccagcgccttctgggagtgccccaacatagtcaac
atagatctctccatgaaccgcatccagcagcttggcagtggcaccttcgcgggcctgacc
aagctctcggtgtgcgagatttacagcaaccctttctactgctcctgcgagctgctgggt
ttcctgcgctggctggcagccttcaccaacgccacccagacccacgaccgtgtgcagtgt
gagtctcctcccgtctacgcgggctacttcctcctgggccaaggccgccacggccaccaa
cgtagcatccttagcaagctgcagtccgtgtgcactgagggctcctacactgctgaagtg
cttggcccgccccgcccggtgcccggccgatcacagccaggacattcgccacctccgcct
cctccagagcccagtgacatgccctgcgctgatgacgagtgcttctctggagacggcacc
acgccactggtggtcctgacgacactggtccctcagacagaggcccgtccctccatgaaa
gtcaagcagctgacccagaactcagccaccatcatggtgcagctgcccagccctttcaac
cgcatgtacacactggagcagtacaacaacagtaaatcgttcacggtgtccaagctgact
cagcctcaggaggagatccgcctcaccaatctctacacgctcaccaactacacgtactgc
gtggtctccacgagttctggcacccatcataaccacacctgccttaccatctgcctgccc
aagccacccagcccacccggccccgtgcccagcccctccacagccacccactacatcatg
accatcctgggctgcctcttcggcatggtgctggtgctgggtgccgtgtactactgcctg
cgaaagcggaggcgacaggaggagaaacacaagaaggccgtggcagcagccgctggcagc
ttgaaaaagaccatcattgaacttaagtacggccctgagatcgaggcacccgggctggct
ccgctgacccagggcccgctgctgggccctgaggctgtgactcgaataccctacctgcca
gctgccaccagcgacgtggagcagtataagctggtggagagcggcgagacccccaaggcc
accaaggggaactacattgaagtgcgcacaggggagccgccggaacgcagaggctgtgag
ctgagccggcctgcccctgaaacccagagctcggtagccgagatctccaccattgccaag
gaagtggacagagtcaaccagatcattaacaactgcatagacgcactcaagtcagaatcc
acctccttccagggcgccaaatcaggggccgtgtccgcggctgagccgcagctggtgctg
ctgtccgagcctctggccagcaagcacagcttcctatcccctgtatacaaagatgccttt
ggccatggtggcctgcagcggcaccacagtgtggaggctgcgaccgggcccccgagggcc
agcacttcatccagcggttctgcacgcagccctcgcaccttccgggctgagacggccggc
gcacataaggccccagccaccgagaccaagtacattgaaaaaagctcacctgtgcccgag
accatcctcactgtgacacccgcggccactgtgctgcgggcggaggccgacaagagtcgc
cagtatggcgagcatcggcactcgtaccccggctctcaccctgccgagccacctgctccg
ccaccacctccacccactcatgagggtttgggaggccgaaaggcatctatcttggagcct
ctgacccggccacgaccccgagacctcgtctactcgcaactgtccccgcagtaccacaac
ctgagctattcatccagccccgagtacacctgcagggcatccccaagcatctgggagcgt
ctcagactaagccggcggagacacaaggatgatgcggagttcatggcggctggccacgcc
ctgcgcaagaaggtccagtttgctaaagacgaggacctgcatgacatcctagactactgg
aaaggcgtgtctgcccagcacaagtcctga

DBGET integrated database retrieval system