KEGG   Rattus norvegicus (rat): 288785
Entry
288785            CDS       T01003                                 

Gene name
Bloc1s1
Definition
(RefSeq) biogenesis of lysosomal organelles complex-1, subunit 1
  KO
K20185  biogenesis of lysosome-related organelles complex 1 subunit 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288785 (Bloc1s1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    288785 (Bloc1s1)
  Others
   BLOC-1 complex
    288785 (Bloc1s1)
SSDB
Motif
Pfam: GCN5L1 GSCFA LOH1CR12 Seryl_tRNA_N BRD4_CDT
Other DBs
NCBI-GeneID: 288785
NCBI-ProteinID: NP_001099411
RGD: 1307564
Ensembl: ENSRNOG00000007784
UniProt: D3ZKU7
Position
7q11
AA seq 125 aa
MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEV
KTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQL
QSAPS
NT seq 378 nt   +upstreamnt  +downstreamnt
atgctgtcccgcctgctcaaagaacaccaggcaaagcagaacgaacggaaggagctgcag
gagaagaggaggcgagaggctatcactgcagccacctgcctgaccgaagcgttggtggat
cacctcaacgtgggtgtggcccaggcctacatgaaccagagaaagctggaccatgaggtg
aagaccctgcaggtccaggctgcccagtttgccaagcagaccggccagtggattggcatg
gtggaaaacttcaaccaggcacttaaggaaatcggggatgtggagaactgggctcggagc
atcgaactggacatgcgcaccattgccacagcgctggagtacgtctacaaagggcagctg
cagtctgcaccgtcctag

DBGET integrated database retrieval system