KEGG   Rattus norvegicus (rat): 290350
Entry
290350            CDS       T01003                                 

Gene name
Loxl2
Definition
(RefSeq) lysyl oxidase-like 2
  KO
K00280  lysyl oxidase-like protein 2/3/4 [EC:1.4.3.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    290350 (Loxl2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     290350 (Loxl2)
SSDB
Motif
Pfam: Lysyl_oxidase SRCR SRCR_2 Hepsin-SRCR
Other DBs
NCBI-GeneID: 290350
NCBI-ProteinID: NP_001099517
RGD: 1308435
Ensembl: ENSRNOG00000016758
UniProt: B5DF27
Position
15p11
AA seq 776 aa
MEIPFGSCLYSCLALLVLLPSLSLAQYESWPYQLQYPEYFQQPPPEHHQHQVPSDVVKIQ
VRLAGQKRKHNEGRVEVYYEGQWGTVCDDDFSIHAAHVVCREVGYVEAKSWTASSSYGPG
EGPIWLDNIYCTGKESTLAACSSNGWGVTDCKHTEDVGVVCSEKRIPGFKFDNSLINQIE
SLNIQVEDIRIRPILSAFRHRKPVTEGYVEVKEGKAWKQICDKHWTAKNSHVVCGMFGFP
AEKTYNPKAYKTFASRRKLRYWKFSMNCTGTEAHISSCKLGPPMFRDPVKNATCENGQPA
VVSCVPSQIFSPDGPSRFRKAYKPEQPLVRLRGGAQVGEGRVEVLKNGEWGTVCDDKWDL
VSASVVCRELGFGTAKEAVTGSRLGQGIGPIHLNEVQCTGTEKSIIDCKLNTESQGCNHE
EDAGVRCNIPIMGFQKKVRLNGGRNPYEGRVEVLTERNGSLVWGNVCGQNWGIVEAMVVC
RQLGLGFASNAFQETWYWHGNIFANKVIMSGVKCSGTELSLAHCRHDEEVVCPEGGVQYG
AGVACSETAPDLVLNAEIVQQTAYLEDRPMALLQCAMEENCLSASAVHTDPTRGHRRLLR
FSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKASFCL
EDTECEGDIQKSYECANFGEQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVVINPNY
EVPESDFSNNIMKCRSRYDGYRIWMYNCHVGGAFSEETEQKFEHFSGLLNNQLSVQ
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggagatcccttttggctcctgcctctacagctgtttggcactgcttgtcttgctgccc
tccctgagcctagcacaatatgagagctggccctaccagctccaatatcccgagtacttc
cagcagccgcctcccgagcaccaccagcatcaggtgccctccgacgtggtgaagatccag
gtccgcctggcgggccagaagaggaaacataatgaaggccgtgtggaggtctattacgaa
ggccagtggggcactgtgtgcgatgatgatttctctatccatgctgcccatgttgtctgc
cgggaagtgggctatgtggaggccaagtcctggactgccagctcctcctacggcccaggc
gaaggccccatctggttggacaacatctactgcacaggcaaagagtcaaccctggcagct
tgctcctctaatggctggggtgtcactgattgcaagcacactgaagatgttggtgtggtg
tgcagtgaaaaaagaattccaggcttcaaatttgacaattcattgatcaaccaaatagag
agcctaaatatacaggtggaagacatccggattcgacccatcctgtctgccttccgccat
cgcaagcctgtgacagagggctacgtggaggtaaaggagggcaaggcctggaagcagatc
tgtgacaagcactggacagccaagaattcccacgtggtctgtggcatgtttggcttccca
gcagagaagacttacaaccccaaagcctacaaaacctttgcctcaaggaggaagctgcgc
tactggaagttttctatgaactgcacgggaactgaagcacacatctccagctgtaagctg
ggccctcccatgttccgggaccctgtgaagaatgccacctgtgagaacgggcagccagct
gtggtcagttgtgtgcctagccagatcttcagccctgatggaccctcaaggttccggaaa
gcctataagccggagcaacccttggtgcgactgagaggtggagcccaggtcggggagggc
cgcgtggaggtgctcaagaatggagaatggggtaccgtctgcgatgacaagtgggacctg
gtgtctgccagcgtggtctgcagggagctgggcttcggcacagctaaagaggctgtcaca
ggctccaggctggggcaagggattgggcccatccacctcaacgaggtccagtgcacaggg
acagagaagtccatcatagactgcaagctcaacacagagtcgcagggctgcaaccacgag
gaagacgccggagtgcgatgcaacatccccatcatgggcttccagaaaaaggtgcgcctg
aatggaggccgcaatccctatgagggtcgagtggaggtactaacagagagaaatgggtcc
ctcgtgtgggggaatgtatgtggccagaactggggcattgtggaagccatggtggtctgc
cggcagctaggattgggctttgccagcaacgccttccaggaaacctggtactggcatgga
aatatcttcgccaacaaagtgatcatgagtggagtgaagtgctcaggaacggagttatcc
ctggcacactgccgccatgacgaggaggtggtctgccccgagggtggggtgcagtatggt
gctggagtcgcctgctcagaaactgcacctgacctggtacttaacgccgagattgtacaa
cagaccgcctatctggaggacaggcccatggccttgctgcagtgtgccatggaggaaaac
tgcctctcagcctccgctgtgcacaccgatcccaccagaggccaccgtcgccttctacgc
ttctcttcccagatccacaacaatggccaatctgacttccgccccaagaatggccgccat
gcatggatttggcatgactgccacaggcactaccacagcatggaagtattcacttactat
gacctcctgagcctcaacggcaccaaggtggctgagggccacaaggccagcttctgcttg
gaggacactgagtgtgagggagacattcagaagagttacgagtgtgccaacttcggagaa
caaggcatcaccatgggctgctgggacatgtatcgtcatgacattgactgccagtggata
gacatcaccgatgtgccccctggagactacctgtttcaggttgtcattaaccccaactat
gaggtgccagaatcagatttctctaacaacatcatgaagtgcaggagccgctatgatggc
taccgcatctggatgtacaattgtcacgtaggtggagccttcagtgaggagacagaacag
aagttcgaacacttcagtggactcctaaataatcagctctctgtgcagtaa

DBGET integrated database retrieval system