KEGG   Rattus norvegicus (rat): 290541
Entry
290541            CDS       T01003                                 

Gene name
Arhgef3
Definition
(RefSeq) Rho guanine nucleotide exchange factor 3
  KO
K20683  Rho guanine nucleotide exchange factor 3/8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    290541 (Arhgef3)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    290541 (Arhgef3)
SSDB
Motif
Pfam: RhoGEF PH_5 PH_13 PH PH_16 zf-Di19
Other DBs
NCBI-GeneID: 290541
NCBI-ProteinID: NP_001099531
RGD: 1310672
Ensembl: ENSRNOG00000014363
UniProt: D4A1J1
Position
16p16
AA seq 524 aa
MVAKDYPFYLTVKRANCSLEAPLGSGVAKDEEPSNKRVKPLSRVTSLANLIPPVKTTPLK
RFSQTLQRSISFRNESRPDILAPRAWSRNATSSSTKRRDSKLWSETFDVCVSQVLTAKEI
KRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEDLL
SQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRC
LESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAEI
NTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVIT
RAVTHNEQLCYQLYRQPIPVKDLTLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKNG
SQSQTHSLQANDTFNKQQWLNCIRQAKETVLSAAGQAGLLDSESLSQSPGTENRELRGET
KLEQMDQSDSESDCSMDTSEVSLECERMEQTDASCANSRPEENV
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggtggccaaggattaccccttctacctcactgtcaagagggcaaactgcagcttggag
gcgcccctgggcagcggggtggccaaggacgaggaacctagtaacaaaagggtcaaaccc
ctttccagagtcacatcgctagcaaacctcatcccacctgtgaagaccacaccgttaaag
cgcttcagccaaaccttgcagcggtccatcagcttccgcaatgagagccgccccgacatc
ctcgcccctagagcctggtccagaaatgccacctcctcaagcacgaagcggagggacagc
aaactctggagtgagaccttcgatgtgtgtgtcagtcaggtgctcacagccaaggagatc
aagagacaggaggcaatttttgagctttctcaaggtgaagaggatttgatagaggacttg
aaattagcaaaaaaggcctaccatgaccccatgctgaaactctcaataatgacagaacaa
gagctgaatcagatttttggaacactggactctctaatccctctccatgaagacctcctt
agtcagcttcgagatgttcggaagcccgatggctcgacggaacacgttggtcccatcctc
gtgggctggctgccttgtctcagctcctatgacagctactgcagcaatcaagttgctgcc
aaagccctgctggaccacaagaagcaggaccacagagtgcaggatttcctccagcgctgc
ttagaatcacccttcagccgcaaactcgacctctggaatttccttgatattccccggagc
cggctagtgaagtaccctctgctccttcgagaaatcctgaggcatacgccaaacgataat
ccagaccagcagcacctggaagaagctataaacatcattcagggaattgtggcagaaatc
aacaccaagactggggaatcggaatgccgttattacaaagagcggcttctttacttggaa
gaaggccagaaagattccctgattgacagctcaagggtcctgtgttgtcatggagagctg
aaaaataaccggggtgtgaaactccatgttttcctgttccaagaagtgctggtgattact
cgagctgtcacgcacaatgagcaactctgctatcagttgtaccggcagcccatccctgtg
aaggacctcactctggaagacctgcaggatggagaagtgcggctgggtggctccctgcgt
ggggccttcagcaacaatgagagaattaaaaacttcttcagagtcagtttcaagaacgga
tcccaaagtcagacccactcactgcaagccaacgacaccttcaacaaacaacagtggctc
aactgtatccgtcaggccaaagaaacggttctgtctgctgccgggcaggctggcttgctt
gactccgagagcctgtcccagagtcctggcactgagaacagggagctgcggggagaaaca
aaacttgagcagatggaccaatcggacagtgagtcggactgcagtatggacacaagcgag
gtcagcctcgaatgcgagcggatggaacagacagacgcttcctgtgcaaacagtaggccc
gaggagaacgtctga

DBGET integrated database retrieval system