KEGG   Rattus norvegicus (rat): 290638
Entry
290638            CDS       T01003                                 

Gene name
B3gnt3
Definition
(RefSeq) N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 precursor
  KO
K07970  beta-1,3-N-acetylglucosaminyltransferase 3 [EC:2.4.1.146 2.4.1.149]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    290638 (B3gnt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    290638 (B3gnt3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.146  beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
     290638 (B3gnt3)
    2.4.1.149  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase
     290638 (B3gnt3)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   290638 (B3gnt3)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 290638
NCBI-ProteinID: NP_001099538
RGD: 1305151
Ensembl: ENSRNOG00000018764
UniProt: D3ZX31
Position
16
AA seq 378 aa
MRLPRLRPVVSLLLALAALLLLLTCQSPPSCPAPESPTEPKDDPAWAPDLSRAHAAPCRA
NLSVSAHPAFARLPSHVRDFLLYRHCRDFAVLREPKATKCAQPAFLLLAIKSSPANYGRR
QVLRTTWARERRVRGASLRRLFLVGSDRDPQQARKFNRLLELEAKAYGDILQWDFHDSFF
NLTLKQVLFLEWQRTHCTNASFVLNGDDDVFAHTDNMVTYLQGRDPDQHLFVGHLIQNVG
PIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARVLPIFPIDDVFLGMC
LQQQGLAPGAHSGVRTAGVLPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALSRPQL
ACGRQSPPLLTGLGGRHP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgcggctgccgcggctgcgccctgtcgtgagcctcctcctggccttggccgccttgctg
ctgctcctgacctgccagtcaccacccagctgccccgcccccgagagtcccacggagcct
aaggatgaccccgcgtgggccccggacctctcccgcgcgcacgccgccccgtgccgggcc
aatctgtcggtgtccgcacaccccgccttcgcgcggttgccctcgcacgtgcgcgacttc
ctgctctaccgccactgccgcgacttcgcggtgcttcgggagccgaaggcgaccaagtgc
gcgcagcccgcgttcctgctgctcgctatcaagtcctcgcccgcgaactacgggcgccgc
caggtgctgcgcacgacgtgggcgcgtgagagacgagtacgcggggcgtcgctgcgccgc
ctcttcctcgtgggctcagaccgcgatccccagcaggcgcgcaaattcaaccggctgcta
gagctggaggcaaaggcatacggcgacattctccagtgggatttccatgactccttcttt
aacctgacacttaagcaggtccttttcctggagtggcagcgaacccactgtaccaacgcc
agtttcgtgctcaacggggacgacgacgtgttcgcccatacggacaacatggtcacctac
ctgcagggccgcgacccggaccaacacctcttcgtggggcacctgatccagaacgtgggt
cccattcgagtgccctggagcaagtacttcatccccactctggtgacagctgaggacaag
tacccgccctactgcggcggcggcggcttcctgctgtcacgctttaccatggccgcgcta
catcgcgcagcgcgcgtcctccccatcttccccatcgacgacgtgttcctgggcatgtgt
ctgcagcagcaggggttggcgcccggggcgcatagcggagtgcgcacggcgggtgtgctc
ccccctagcccgcgtgtgtcatccttcgacccctgcttctaccgtgacctgctcctcgtg
caccgcttcctgcccttcgagatgctgctgatgtgggatgcgctgagccggcctcagctc
gcctgcggcaggcagagcccccccctactgacaggtttggggggtcgacacccctga

DBGET integrated database retrieval system