KEGG   Rattus norvegicus (rat): 290655
Entry
290655            CDS       T01003                                 

Gene name
Crlf1
Definition
(RefSeq) cytokine receptor-like factor 1
  KO
K24481  cytokine receptor-like factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    290655 (Crlf1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   290655 (Crlf1)
SSDB
Motif
Pfam: fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N Lep_receptor_Ig ObR_Ig Interfer-bind
Other DBs
NCBI-GeneID: 290655
NCBI-ProteinID: NP_001099544
RGD: 1311371
Ensembl: ENSRNOG00000020030
UniProt: D3ZIV9
Position
16p14
AA seq 425 aa
MPAGGPGPAAQSARRPPRRLSSLWSPLLLCVLGVPQGGSGAHTAVISPQDPTLLIGSSLH
ATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCH
ARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAHGETFLHTNYSLKYKLRW
YGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDVLDVVTTDP
PPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCR
LAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGVCEPRGGE
PSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGAA
RGPAG
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcccgccggtggcccgggccccgccgcccaatccgcgcggcggccgccgcggcggctc
tcctcgctgtggtcgcctctgttgctctgtgttctcggggtgcctcagggcggatcggga
gcccacacagctgtgatcagtccccaggaccccactcttctcatcggatcctcccttcat
gctacgtgctctatacatggagacacaccgggggccactgctgagggcctctactggacc
ctcaacggccgccgcctgccctcagagctgtcccgtctcctcaacacctccaccctggcc
ttggccctggctaaccttaatgggtccaggcagcagtcaggggacaatctggtgtgtcac
gcccgagatggcagcattctggctggttcctgcctctatgttggtctgcccccggagaag
ccctttaacatcagctgctggtcccggaacatgaaggacctgacatgccgttggacaccg
ggtgcacatggggagacattcctacacaccaactactccctcaagtacaagctgaggtgg
tatggtcaggacaacacatgtgaggaatatcacactgtgggccctcactcgtgccatatc
cccaaagacctggccctcttcacgccctatgagatctgggtggaagccaccaatcgcctg
ggttcagcgagatctgacgtgctcacactggatgtcctggacgtggtgaccacggaccct
ccacccgacgtgcacgtgagccgcgttgggggcctggaggaccagctgagtgtgcgctgg
gtctcaccaccagctctcaaggatttcctcttccaagccaaataccagattcgctaccgc
gtggaggacagcgtggactggaaggtggtggatgacgtcagcaaccagacctcctgccgt
ctcgcgggcttgaagcccggcaccgtttacttcgtccaagttcgttgtaacccattcggg
atctatgggtcgaaaaaggcgggaatctggagcgagtggagccaccccaccgctgcctcc
acccctcgaagtgagcgcccgggcccgggcggcggggtgtgcgagccgcggggcggcgag
cctagctcgggcccggtgcggcgcgagctcaagcagttcctcggctggctcaagaagcac
gcgtactgctcgaaccttagcttccgcctgtacgaccagtggcgtgcttggatgcagaag
tcacacaagacccgaaaccaggacgaggggatcctgccctcgggcagacggggtgcggcg
agaggtcctgccggctaa

DBGET integrated database retrieval system