KEGG   Rattus norvegicus (rat): 290705
Entry
290705            CDS       T01003                                 

Gene name
Nek1
Definition
(RefSeq) NIMA-related kinase 1
  KO
K08857  NIMA (never in mitosis gene a)-related kinase 1/4/5 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    290705 (Nek1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    290705 (Nek1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    290705 (Nek1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     290705 (Nek1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NEK family
   290705 (Nek1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    290705 (Nek1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    290705 (Nek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH DUF3701
Other DBs
NCBI-GeneID: 290705
NCBI-ProteinID: NP_001099552
RGD: 1309375
Ensembl: ENSRNOG00000010418
Position
16p12
AA seq 1200 aa
MEKYVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKEREESRREVAVLANMKH
PNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGTLFQEDQILDWFVQICLALKHVH
DRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPY
NNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSLHYSYDLRSLLSQLFK
RNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLKTVSKFGPQPIPGKRPASGQGVS
SFVPAQKITKPSAKYGVPITYKKYGDKKLLEKKPPPKHKQAHQIPVKKMNSGEERKKMSE
EAAKKRRLEFIEKEKKQKDQIRFLKAEQLKRQEKQRLERINRAREQGWRNVLRAGGSGEV
KASFFGSGGAVSPSPCSPRGQYEHYHAIFDQMQQLRAEDNEARWKGRIYGRWLPERQKGH
LGVERAKQVEEFLQRKQEAMQNKARAEGHVVYLARLRQIRLQNFNERQQIKAKLRGENKE
AGGTKGQDATEEADMRLKKMESLKAQANARAAVLKEQLERKRKEAYEREKKVWEEHLVVR
VKSSDVPPSMEHHEAGGSPSQQQMKPVISVTSALKEVGLDGSLTESQETSEEMEKSNNAI
SSKREILRRLNENLKAQEDEKEKHHHADSCETVGHRDEREYEKENAISSDRKKWEMGGQL
VIPLDEVTLDASFSASEKHTVGEVIKLDSSGSPRKVWGKSPTDSVLKILGEAELQLQTEL
LENTPFKSEVCVEEENYKPLLTGEENLQCISKEVNPSATVDTETNSPKFAKVSPAMSEGN
VEEPDDLETEVLQEPSAIPSDGSLPPVVNEVWTRAKATGLEDSIAVQQNDVCEERIPGTV
DQSCKDHIEPAGNDSPQSGCDEEKSVQPELFFQKVVHSKDLNLVQSAHRSPEEAIPIRSH
SDSPPKAKSKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVHQDSLE
IEELEDEHIKEGPSDCEDIVFEETDTDLQELQASMEQLLREQPGDEYSEEEESVLKSSNV
ERAARGTDVPDEEDNPSSESALNEEWHSDNSDAETTSECEYDSVFNHLEELRLHLEQEMG
FEKFFEVYEKVKAIHEDEDENIEISSTIVENILGTEHQHLYAKILHLVMADGAYQEDNDE
NT seq 3603 nt   +upstreamnt  +downstreamnt
atggagaagtatgttagactacagaagattggagaaggttcatttggaaaagctgttctt
gttaaatctacagaggatggcagacattatgtcatcaaggaaattaacatctcaagaatg
tccgataaagaaagagaagaatcaaggagagaggtcgcagtgttggcaaacatgaagcat
ccaaatattgtccaatacaaagaatcattcgaagaaaatggctctctctacatagtaatg
gattactgtgaaggaggtgatctgtttaaacgaataaatgctcagaaaggcactttgttt
caagaagatcagattttggactggtttgttcagatatgtttggctttgaagcatgtacac
gatagaaaaattcttcaccgagacataaagtcacagaacatatttctaaccaaagatggg
acagtgcagcttggagattttggaattgctcgagttctcaatagtactgtagagctggct
cgaacttgcatagggactccatactacttgtcacctgaaatctgtgaaaacaagccttac
aacaataaaagtgacatttgggctttgggctgtgtcctttatgagttgtgtacacttaaa
catgcatttgaagctggaaacatgaaaaacctggtactgaagataatatctggatccttt
cctccagtgtctctacattattcctatgatctccgcagcttgctctctcagctgtttaaa
agaaatcctagggatagaccatcagtcaactccatattggagaaaggctttatagctaaa
cgaatcgaaaagtttctctcacctcagcttattgcagaagaattttgtctgaaaacagtt
tcaaagtttggaccacagcctatcccaggtaaaagaccagcatcaggacaaggtgtcagt
tcttttgtccctgctcagaaaatcacaaagccttctgctaaatatggagtgcctataaca
tataagaagtacggagataaaaagttacttgaaaaaaaaccacccccaaagcataagcag
gcccatcagattccagtgaagaaaatgaattctggagaagaaaggaagaaaatgtctgag
gaagcagcaaaaaaacgaaggttggaatttattgagaaagaaaagaagcaaaaggatcag
atcaggttcctgaaggctgagcagctgaagaggcaagagaagcagcggttggagaggata
aatagggccagggaacaaggatggaggaatgttttaagggctggtggaagcggtgaagta
aaggcttccttttttggcagtggaggagctgtgtctccatcaccttgttctcctcggggc
cagtatgaacattaccatgccatctttgaccaaatgcagcagctaagagcagaagataat
gaagcgagatggaaagggagaatatatggtcgatggctccctgaaaggcaaaaaggacac
ctaggtgtagagagagccaaacaagtggaagaattcctacagcgtaaacaagaagctatg
cagaataaagcccgagcagaaggacatgtggtttatctggcaagactgaggcaaataaga
ctacaaaattttaatgagcgccaacagattaaagccaaacttcgtggtgagaataaagaa
gctggtggtaccaaaggacaagacgcaactgaagaggctgacatgaggctcaaaaagatg
gagtcacttaaggcccaagcaaatgcacgtgctgctgtactaaaagaacagctagagcga
aaaagaaaggaagcttatgaaagagaaaagaaagtgtgggaagaacatttggtggtgagg
gtaaaaagctcagatgtccctccatctatggagcatcatgaagcaggtggttctccatca
cagcagcagatgaaacctgttatttctgtgacttcagctttgaaagaagtgggcctggat
ggaagtttaactgagtcccaagaaacttcagaagaaatggaaaagagtaacaatgctatt
tcaagtaagcgagaaatactgcgtaggctgaatgaaaatcttaaagctcaagaggatgaa
aaggaaaagcatcatcacgctgattcttgtgagaccgttggtcacagagatgagagagag
tatgagaaggaaaatgccatttcctctgatcgcaagaaatgggagatgggaggtcagctt
gtgattcctctggatgaagtgacactggatgcatccttctctgcttctgaaaaacatact
gtgggagaggttattaagttagattctagtggctctccaagaaaagtctgggggaaaagc
cctacagattctgtgctgaagatacttggagaagctgaattacagctacagacagaacta
ctagaaaacacgccttttaaaagtgaggtttgtgttgaagaggagaactacaaaccccta
ctcactggagaagagaatctgcagtgtatttcaaaagaagtaaacccatcagccactgtt
gatactgaaacaaacagtccaaagtttgctaaggtgtctccagcaatgtccgaaggaaat
gtggaagaacctgatgatttggaaacagaagttctacaagagccaagtgccataccctca
gatgggagtttgccgcctgttgttaatgaggtgtggaccagagctaaggcaactgggttg
gaggatagcattgctgtgcagcagaatgacgtttgtgaagagcgaattccagggactgtg
gaccagtcctgtaaggatcatatagaacctgcaggaaacgattctccgcagtctggctgt
gatgaagagaagtcagtacagccagaattgtttttccagaaagtggttcactccaaggac
ttgaacttagttcagtcagctcatcgttccccagaagaagcaattccaattcgatctcac
tctgattctccaccaaaagctaaaagcaagaattccctactgattggactttccactggt
ctgtttgatgcaaacaacccaaagatgctgaggacctgttcacttccagacctttccaag
ctcttcagaaccctaatggatgttcccactgtgggagacgttcatcaagacagtcttgaa
atagaggagcttgaggatgaacatattaaagaagggccctcggattgcgaggacattgta
tttgaagaaactgacacagatttacaggagcttcaggcctcaatggagcagctgcttagg
gagcaacccggtgacgaatacagtgaggaggaagagtctgtcttaaaaagcagcaatgtg
gagcgggcagcaagagggacagatgtcccagatgaggaggacaaccccagcagtgaaagc
gccctaaacgaggaatggcactcagataacagtgatgctgagactactagtgagtgtgaa
tatgacagtgtctttaaccatttagaggaactaagacttcacttggaacaagaaatgggc
tttgaaaagttctttgaggtctatgagaaagtaaaggctattcatgaggatgaagatgaa
aatattgaaatttcttcaaccatagtcgagaacatcttgggcactgagcatcagcacctt
tatgccaagattctgcatctagtcatggcagacggagcctatcaggaagataatgatgaa
taa

DBGET integrated database retrieval system