KEGG   Rattus norvegicus (rat): 290805
Entry
290805            CDS       T01003                                 

Gene name
Wrn, RGD1564788
Definition
(RefSeq) Werner syndrome RecQ like helicase
  KO
K10900  werner syndrome ATP-dependent helicase [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    290805 (Wrn)
   03400 DNA repair and recombination proteins [BR:rno03400]
    290805 (Wrn)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     290805 (Wrn)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     290805 (Wrn)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     290805 (Wrn)
SSDB
Motif
Pfam: DNA_pol_A_exo1 DEAD Helicase_C RQC HTH_40 HRDC RecQ_Zn_bind ResIII
Other DBs
NCBI-GeneID: 290805
NCBI-ProteinID: XP_006222319
RGD: 1564788
Ensembl: ENSRNOG00000015440
UniProt: F1LTH9
Position
16q12.3
AA seq 1400 aa
METTSLRRKFPEWMSTQNKSCATQEKASIQKSVLEDDLPFLEFTGSVVYSYEASDCSFLS
EDISMHLSDGDVVGFDMEWPPIYKQGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKM
LLENKSIRKAGVGIEGDQWKLLRDFDVKLESFVELTDVANRKLKCAETWSLNGLVKHVLG
KQLLKDKSIRCSNWSDFPLSEDQKLYAATDAYAGLIIYQKLENLGDAVQVFALNKAEESL
PMEMKKQLNSISEEMRDLANHFPVTCRNLETLQRVPMILENISENLCSLRKVICASTDTG
TKLEPGGGSHLLSSEGSAAVGEKEKQMGEHRTFPKIKEEAWDPELDSLVKHEAVDVFRKQ
VKQEKGGFEDEMEDSLLREVMERTCLMPSISEYDLQDLEQQAKEEKHNAISHQFSEHLSP
DDDEKDSSYIIESDEDLEMEMLKSLENLNSDVGEPTHSKWLETGGSVNLPPEEEDGDGKE
AFEEEQEEEDHLLPEPNAKQINCLKTYFGHCSFKPVQWKVIHSVLEERRDNVVVMATGYG
KSLCFQYPPVYTGKIGIVISPLISLMEDQVLQLEMSNIPACLLGSAQPKNILGDIKLGRY
RIIYITPEFCSGNLDLLQQLDSNIGITLIAVDEAHCISEWGHDFRSSFRTLGSLKTALPL
VPVIALSATASSSIREDIIRCLNLKDPHITCTGFDRPNLYLEVERKTGNILQDLKPFLVR
KTSSAWEFEGPTIIYCPSRKVTEQVTVELGKLNVACQAYHAGMKISERKDIHHRFLRDEI
QCVVATIAFGMGINKADIRKVIHYGAPKEMESYYQEIGRAGRDGLQSSCHLLWAPADFNT
TRNRLIEIHNEKFRLHKLKMMVKMEKYLHSSRCRRQIILSHFEDKRLQKASLAVMGTEKC
CDNCRPRLNHCSSANNSEDTAQDFGPQAFQLLSAVDILQEKFGIKIPILFLRGSNSQRLP
EKYHNHRLFGAGKEQAESWWKALSHHLIAEGFLVEVPKQNKFIKTCSLTKKGRKWLGEAI
LQSPPSLVLQADEEAFSRKALLSSSNPVSSETKPHSSNQKPTGSSTQQSNLEGAYSDKVP
EKFSSGSNIPKKSVVMQSPGTSYSSWEPVISAQEVDTRTVLYARLVEARQKHANEVDVPP
AVLATNKVLLDMAKMRPTTVENVKQIDGVSEGKAALLAPLTEVIKHFCQVNSVQTDLFAS
TKPQEDEEKSQEMENKACSLPQSAAVTYALFQEKKMSLHSIAENRLLPLTAVGMHLAQAV
KAGHPLDMERAGLTPETRKIIMDVIRNPPINSDMYKVKLIRMLVPENIDTYLIHMMIEIL
ESGSHGRTQPSCDSNRKRCLPSPAESCGSFKKSKEMVTETKAPSEMSQRKLPEWFVKGNV
PLAATGSSSMAKTKKKGLFS
NT seq 4203 nt   +upstreamnt  +downstreamnt
atggaaaccacttccctgcggcggaaatttccagaatggatgtcaacgcagaataaaagc
tgtgccacacaagaaaaggcaagcattcagaagagtgttcttgaagatgacctcccattc
ttagaatttactggatctgttgtttacagttatgaggccagcgattgctctttcctgtct
gaagacattagcatgcatctgtctgacggagatgtggtaggatttgacatggaatggcca
cccatatacaagcaagggaaacgaagcagagttgcagtgatccagctgtgcgtgtctgag
agcaagtgttacttgtttcacatttcttctatgtcagttttcccccaggggttaaaaatg
ttactagaaaacaaatcgattaggaaggcaggcgtgggcattgaaggggaccagtggaaa
cttctgcgtgactttgatgtcaagttggagagttttgtggagttgacagacgtcgccaac
agaaagctcaagtgcgcggagacctggagcctcaatggtctggttaaacacgtcttagga
aaacagcttttgaaagacaagtccatccgctgtagcaattggagtgatttccccctctct
gaggaccagaaactgtatgcagccactgatgcttacgctggtctcatcatctatcaaaaa
ttagaaaatttgggtgatgccgtgcaagtgtttgctctaaataaagcagaggaaagccta
cctatggagatgaagaaacagttgaattcaatctctgaagaaatgagggaccttgccaat
cattttcctgtcacttgcagaaatttggaaactctacagagggttcctatgatattggag
aacatttcagaaaatctgtgttcattgagaaaggtgatctgtgcttctacagacactggg
actaaactggagccaggcggtggttcgcatttactgtcatccgagggttcagctgctgtc
ggagagaaagagaaacaaatgggagaacacaggacttttcctaaaattaaagaagaagca
tgggacccagaacttgacagtttagtgaagcatgaggcggtcgatgttttcagaaagcaa
gtgaagcaagaaaaaggtggatttgaggatgaaatggaagacagtctgttgagagaagtt
atggaaagaacttgtttgatgccaagtatttcagaatatgacctccaagatttggaacag
caagccaaagaagaaaaacataatgctatttctcaccagttttctgagcacttatctccc
gatgatgatgagaaagactcctcttacatcattgaaagtgatgaagacttagaaatggag
atgctgaagtctttagaaaatctaaacagcgatgtgggggagcccactcattccaaatgg
ctggaaacgggaggcagtgtgaaccttcctcccgaggaggaagatggagacggaaaggaa
gccttcgaagaggagcaggaagaagaggaccatttattgccagaacccaatgcaaagcaa
attaattgcctcaagacttatttcggccactgcagttttaaaccggtccagtggaaagtc
atccattcagtattagaagaaagaagagataatgttgtcgtcatggcaactggatacgga
aagagtctgtgcttccagtatccgcccgtttatacaggcaagatcggcattgtcatttcg
ccccttatctccttaatggaagaccaggtcctccagcttgaaatgtccaacattccagcc
tgtttacttggatcagcacaaccaaaaaatattctaggagatattaaattaggcagatat
aggatcatctacataactccagagttctgttctggtaacttggacctactccagcaactt
gactctaatattggtatcacactcattgctgtggatgaggctcactgcatttctgagtgg
ggtcacgactttagaagttcattcaggactctgggctctctgaagacagcactcccactg
gttccagtcattgccctctctgctaccgcgagctcttccatccgggaagacattatacgg
tgcttaaacttgaaagaccctcacatcacctgcactgggtttgaccgacccaatctctac
ttagaagttgaacggaaaacagggaatatacttcaggatctaaagccatttctcgtccga
aagacaagttctgcctgggaattcgaaggtccaaccatcatctattgtccttcgagaaaa
gtgacagaacaagttactgttgaacttgggaaactgaatgtagcctgccaggcataccac
gccggcatgaaaattagcgaaaggaaggacattcatcataggttcctgagagatgaaatc
cagtgtgttgtagctactatagcctttggaatgggcattaataaagccgacattcgcaaa
gttattcactacggcgctcccaaggaaatggagtcctattaccaggaaatcggaagagct
ggccgtgatggacttcagagttcctgtcacttgctctgggctccagcagactttaacaca
actaggaatcgccttattgagattcacaatgaaaagttccggttacataaattaaagatg
atggtaaagatggagaaataccttcattccagtcgatgtaggcgacaaatcatcttgtcc
cattttgaggacaaacgactacagaaggcctccttggccgttatgggaactgaaaaatgc
tgtgataattgcaggcccagactgaatcattgctcttctgctaacaactcagaggataca
gcccaagactttgggccacaagcattccagctactatctgccgtggacatcctgcaggag
aaatttggaattaagatcccgattttatttctccgaggatccaattctcagcgtcttcct
gagaaatatcacaatcacaggctttttggtgctggcaaggagcaagcagagagttggtgg
aaggccctttctcaccatctcatagctgaaggattcttggtagaggttcccaagcaaaac
aaatttataaagacttgttccctcacaaaaaagggtaggaagtggcttggtgaagccatt
ttgcagtctcctcccagccttgtccttcaagctgacgaagaggcgttttcaaggaaggct
ttgctatccagttctaatcccgtatcttcagaaacgaagccacactcctctaatcaaaag
ccaactgggtcaagtacacagcagtctaatttggagggagcgtattctgacaaagtgcct
gagaaattttcttctgggagtaacattcctaaaaaaagcgtcgtgatgcagtcaccggga
acatcgtacagctcctgggaacctgtcatttcggcccaagaggtcgacacccggactgtg
ctgtatgccaggttggtggaggcacggcagaagcacgctaatgaggtggatgtacctcca
gctgtgctagcaaccaacaaggttctgctggacatggccaagatgagaccgactactgtt
gaaaacgtgaaacagattgacggtgtctccgaaggcaaagctgctctgttggcccctctg
acggaagtcatcaaacatttctgtcaagtaaatagtgttcagacagacctcttcgccagt
accaaacctcaggaggacgaggagaaaagtcaggagatggagaacaaagcctgctcactc
ccccagtctgcggccgtcacatatgctctattccaggaaaagaaaatgtccttacacagc
atagctgagaatagacttctgcctctcacagcggtcggcatgcacttagcccaggcggtg
aaagccggccaccccctggatatggagcgagctggcctgaccccagagactcggaagatt
attatggatgttatccgaaaccctcccatcaactcagatatgtataaagttaaactcatc
agaatgttggttcctgaaaacattgacacgtacctcatccacatgatgattgagatccta
gagagcgggtcccacggcaggacccagccttcctgtgattccaacaggaagaggtgtctc
cccagccccgcagagagttgcggcagctttaagaagagcaaggagatggtcactgagacc
aaggcaccatctgagatgtcccagagaaaattacctgaatggtttgtcaaaggaaatgtg
cccttggctgctactggcagctcatcaatggccaagacaaaaaagaaaggtctttttagt
taa

DBGET integrated database retrieval system