KEGG   Rattus norvegicus (rat): 290905
Entry
290905            CDS       T01003                                 

Symbol
Col4a1
Name
(RefSeq) collagen alpha-1(IV) chain precursor
  KO
K06237  collagen type IV alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04974  Protein digestion and absorption
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    290905 (Col4a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    290905 (Col4a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    290905 (Col4a1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    290905 (Col4a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    290905 (Col4a1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    290905 (Col4a1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    290905 (Col4a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    290905 (Col4a1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    290905 (Col4a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    290905 (Col4a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    290905 (Col4a1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    290905 (Col4a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   290905 (Col4a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   290905 (Col4a1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 290905
NCBI-ProteinID: NP_001128481
RGD: 1307148
Ensembl: ENSRNOG00000016281
UniProt: F1MA59
Position
16
AA seq 1669 aa
MGPRLSVWLLLPLAALLLHEERSRAAAKGDCGGSGCGKCDCHGVKGQKGERGFPGLQGVI
GFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGI
PGAPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPP
GVPGQAQVKEKGDFAPTGEKGQKGEPGFQGTPGYGEKGEPGKPGPRGKPGKDGEKGEKGS
PGFPGESGYPGLPGRQGPQGEKGEPGLPGPPGTVVGTRPLGEKGERGYPGSPGLRGEPGP
KGYPGSPGQPGPPGFAVPGQTGAPGFPGERGEKGERGSPGVSLPGPSGRDGAPGPPGPPG
PPGQPGHTNGIVECQPGPPGDQGPPGIPGQPGLTGEVGQKGQKGESCLACDTEGLRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLK
GDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDI
GPPGPPGVGPIGPIGEKGQAGLPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFP
GPQGDRGFPGTPGRPGNPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNG
LPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGI
RGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGVKGEKGFPGFPGLDMPG
PKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGAPG
LPGEKGDHGFPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIG
PTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGIPGSPGLPGPKGSVGGMGLPG
SPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGE
KGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEQGLPGRGFPGFPGTKGDKGSKGEVGFPGLAGSP
GIPGAKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPG
IDGPKGDKGNPGWPGAPGAPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGQKG
LPGLQGVKGDQGDQGIPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPK
GQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAV
HSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt   +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggcttctgctgccgctcgccgcccttctgctccacgag
gagcgcagccgggccgctgcgaagggtgattgtggtggctctggctgtggaaaatgtgac
tgtcatggtgtgaagggacaaaagggagagagaggctttccagggttacaaggtgtcatt
ggatttcctgggatgcaaggacctgaggggccacatggaccaccaggacaaaagggtgat
gctggagaacctggacttcctggaacgaaagggacacgaggaccccctggagcagctggc
taccctgggaatcccggacttcctggtattcctggccaggatggtcctccaggtccccca
ggtatcccaggatgcaatggtacaaagggagagagagggccactcggtcctcctggcttg
cctggattcagcgggaatcctggaccaccggggttaccaggaatgaagggagatcccggt
gaaattctcggccatgttcctgggaccctgctgaaaggagagagaggatttcctggtatc
cctggggcgccgggctcaccagggttgccaggactccagggacctgtcggtcctccggga
tttactggaccaccgggtcctccaggccctcctggacctcctggagaaaaggggcagatg
ggatccagcttccaaggaccaaaaggcgacaagggagaacaaggggtcagtggtcccccg
ggagtacctggacaggcacaagttaaggaaaaaggagactttgccccaacaggagaaaag
ggtcagaaaggtgaacctggattccagggaacaccaggatatggagagaaaggtgaacct
ggcaagccaggacctcggggaaaacctggaaaagatggtgaaaaaggagaaaaggggagc
ccgggctttcctggtgaatccggatacccaggtcttccaggccggcagggccctcaggga
gagaagggtgaacctggacttccaggcccccctggaactgtggtaggcaccaggccattg
ggagagaaaggagagcgaggctacccgggatccccagggttaagaggagagcccggtcct
aaaggttaccctggatcgccaggccaaccaggccctccaggtttcgctgttccaggccag
actggtgctccgggcttcccaggtgaaagaggagaaaaaggtgaaaggggatctccaggt
gtgtctttaccaggaccaagtggaagagatggagccccagggcctcctggccctcctggc
ccccctgggcaaccaggccacacgaacggcattgtggagtgtcaacctggaccacctggg
gaccagggtcctccaggaattccaggacagccaggtttgacaggcgaagttggacagaaa
ggtcagaaaggagagagctgccttgcctgtgacacagaaggacttcgaggccccccaggg
ccacaggggcctccaggagagattggtttccctggacagccaggggctaaaggtgaccga
ggcctgccaggcagagatggtcttgaaggattgccgggtccacaaggttcaccggggctc
ataggccagcctggagctaagggagagcccggcgagatattttttgacatgcgactcaaa
ggtgacaaaggagacccaggttttccaggacagccagggatgccaggaagagcaggaact
ccgggaagagacggccacccaggactccccggacccaaaggctccccgggttcaatagga
ttgaagggagagagaggtccccctggaggagttggctttcctggtagtcgtggagacatt
ggccctcctggacccccaggagtcggtcccatcggtcccattggtgaaaaaggacaagca
ggccttcctgggggccccgggtccccaggtcttccaggtccaaagggtgaagcaggaaag
gttgtcccactccccggcccccctggagctgcaggacttccaggatcccctgggttccca
gggccacaaggtgaccgaggcttcccaggaaccccaggacggccaggcaacccaggagag
aagggtgctgtgggccaaccaggaattggatttcccgggcttcctggccccaaaggtgtt
gatggcttgcctggagagataggacgaccggggagtccaggtcgccctggatttaatggc
ttacctggcaacccaggaccgcaaggccaaaagggagaacctggcattgggcttccagga
ctcaaagggcagccaggtcttccaggtatccctggcacacccggagagaaaggcagcatc
gggggacctggcgttccaggagaacaggggttgactggccctcccggactccaggggatc
agaggtgacccaggacctcctggggttcaaggccctgcaggtccaccaggggttccagga
ataggaccacccggagctatgggccctcccggagggcaaggaccaccaggttcatcaggt
ccacctggagttaaaggagagaagggattccctggattcccaggactggatatgcctggc
cccaaaggagataaaggctctcaaggacttcctggcctcacaggacagtcagggctccct
ggcctccctggacagcaggggactcctggagttccagggttcccaggttctaaaggtgaa
atgggcgtcatgggaaccccgggacaaccaggctcaccaggaccagcaggcgccccaggg
ttacccggagagaaaggagaccatggctttccgggctcctcgggacccaggggcgaccct
ggcttcaaaggtgataaaggtgatgtcgggcttcctggcatgccaggatccatggagcac
gtggacatgggcagcatgaaggggcagaaaggagaccagggagagaaaggacaaattgga
cccactggtgataaaggttcccgaggagaccccggaacaccaggagtgcccgggaaggat
gggcaggcagggcaccctggacagccaggacctaaaggtgacccaggccttagtggaata
ccaggatcccctggacttcctggacccaaaggatcggttggaggaatgggcttgccaggt
tcgcccggagagaaaggcgttccgggcatccctggctcacagggtgtccctggctcacct
ggagagaaaggagctaagggagagaaagggcagtcaggtctccctggcattggaattcct
ggacggcctggtgacaagggagatcaggggcttgcaggtttcccaggcagccctggtgag
aagggagagaaaggcagtgccggaaccccagggatgccagggtccccaggcccaagaggc
tctccagggaacatcggccatccaggaagcccaggcctgcctggagaaaaaggagacaaa
ggcctcccaggactggatggtgttcccggtgtcaaaggagaagcaggtcttcctgggact
cctggccccacaggcccagctggccagaagggagaacctggcagtgatggaatcccgggg
tcggcaggagagaagggtgaacaaggtttgccaggaagaggcttcccaggcttccccggc
accaaaggagacaaaggttccaagggtgaagtgggtttccctggccttgccggaagtcct
gggattcctggagccaaaggcgagcaaggattcatgggtcctcccggccctcaaggacag
ccgggcttacctggcactcctggccaccctgtggaggggcccaaaggagaccgaggacct
cagggtcaacccggcctgccagggcatccgggacctatggggccaccagggttccctgga
atcgatgggccaaaaggtgacaagggaaatccaggttggccaggagctcctggggctcca
ggccctaagggagacccaggattccaaggcatgccgggcattggcggctctccagggatc
acaggttcaaagggagatatgggaccgcctggcgttccaggattccaaggtcagaaaggt
cttcctggcttgcagggagtgaagggagatcagggagatcaaggcatacccggccctaaa
ggtctccaaggtccccctgggcccccaggtccctacgatgtcatcaaaggagaaccaggg
ctcccaggtcctgagggtcctcctggtctcaaaggacttcaaggaccaccaggtccaaaa
ggacagcaaggtgtgacaggctccgtgggcttgcctggacctccaggtgtccctgggttt
gatggtgcccctggccagaaaggagagactggaccatttggaccacctggtccgagaggg
tttcctggtccaccaggccccgatgggctgccaggatccatgggtcccccgggtacccca
tctgtggaccatggcttccttgtgaccaggcatagtcagacaacagatgacccgctgtgt
cccccagggaccaaaattctttaccatgggtactctctgctctatgtccaaggaaacgag
cgggcccatggtcaggacttgggtacggctggcagctgtctgcgcaagttcagcaccatg
cccttcctcttctgcaacatcaacaacgtctgcaacttcgcctccaggaacgactactcc
tactggctgtccactccggagcccatgcccatgtccatggcacctatctctggggacaac
atccggcccttcattagcaggtgtgcagtttgcgaagcgcccgccatggtgatggcggtg
cacagtcagaccatccagatcccgcagtgccccaacggttggtcctcactgtggattggc
tattcctttgtgatgcacaccagcgctggtgctgaaggttctggccaagcccttgcatct
cccgggtcctgtctggaagagtttagaagtgccccattcatcgagtgccatggcagagga
acgtgcaattactacgcgaatgcttacagcttttggctcgccaccatagagagaagcgag
atgttcaagaagcccacgccgtccaccttgaaggcaggggagctgcgcacgcatgtcagc
cgctgccaagtgtgcatgagaagaacatag

DBGET integrated database retrieval system