KEGG   Rattus norvegicus (rat): 290907
Entry
290907            CDS       T01003                                 

Gene name
Lig4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    290907 (Lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    290907 (Lig4)
Enzymes [BR:rno01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     290907 (Lig4)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     290907 (Lig4)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_IV BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme SSPI
Other DBs
NCBI-GeneID: 290907
NCBI-ProteinID: NP_001099565
RGD: 1304639
Ensembl: ENSRNOG00000014605
UniProt: D4A0U6
Position
16q12.5
AA seq 911 aa
MASSQASRTVAAHVPFADLCSTLERIQKGKDRAEKIRHFKEFLDSWRKFHDALHKNKKDV
PDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDAQKLLNYRTPSGARS
DAGDFATIAYFVLKPRCLQKGSLTIQKVNELLDLVASNNSGKRKDLVKKSLLQLITQCSA
LEQKWLIRMIIKDLKLGVSQHTILSIFHNDAVELHNVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFRPMLAAVADVERVEKDMKQQSFYIETKLDGERMQMHKDGALYRYFSRNGYNYTD
QFGESPQEGSLTPFIHNAFKTDVQVCILDGEMMAYNPTTQTFMQKGVKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGRETLRKRYDILSSTFTPIQGRIEIVQKTQAQTKQEVVDALND
AIDKREEGIMVKHPLSIYKPDKRGEGWLKIKPEYVTGLMDELDLLIVGGYWGKGSRGGMM
SHFLCAVAETPPPGDKPSVFHTLCRVGSGYTMKELYDLGLKLAKYWKPFQRKSPPSCILC
GTEKPEVYIEPQNSVIVQIKAAEIVPSDMYKTGSTLRFPRIEKIRDDKEWHDCMTLDDLE
QLRGKASGKLATKHLHIGDDDEPREKRRKPISKTKKTIGIIEHLKAPNLSNINKVSNVFE
DVEFCVMSGLDGYPKPDLENKIAEFGGYIVQNPGPDTYCVIAGSENIRVRNIISSDRHDV
VKPEWLLECFKTKTCVPWQPRFMIHMCPSTKQHFAREYDCYGDSYFVDADLDQLKEVFLR
IKPSEQQTPEEMAPVIADLECRYSWDHSPLSMFRHYTVYLDLYAVINDLSSKIEATRLGV
TALELRFRGAKVVSRLSEGVSHVIIGEDQRRVSDFKTFRRTLKKKFKILQERWVIDSVDK
CELQEENLYLL
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggcttcctcacaagcctcacgaactgtcgcagctcatgtcccctttgcagacttgtgc
tccaccttagaacgaatacagaaaggtaaagaccgtgcagaaaaaatcaggcacttcaag
gagtttctggattcttggagaaaatttcatgatgcccttcataagaacaagaaggatgtt
ccggactctttttacccagcaatgagacttattctccctcagctagagagagagaggatg
gcttacggaatcaaagaaaccatgctggctaagctttacatcgaattgctcaatttacca
agagaaggcaaggatgcccagaagctcctgaattaccgaacccccagtggagctcgctca
gatgctggggactttgccacgattgcatactttgttttgaagccaaggtgcttacagaaa
ggaagcttaaccatacagaaggtgaatgaactcttagacttagttgccagcaataactct
ggcaaaagaaaagatctagtgaaaaagagccttcttcagttaataacccagtgttcagca
ctcgagcaaaagtggctgattcgcatgattattaaggacttaaagcttggtgtcagtcag
cacacgatattgtccatcttccacaatgatgcagtcgagttgcacaatgtcaccacagat
ctggaaaaggtctgtaggcagctacatgacccctccgtagggctcagcgacatctccatc
actttgttctctgcctttaggccaatgctagctgctgtagcagatgtggagcgtgtggag
aaggacatgaagcagcagagtttctacatcgaaactaagctcgatggcgagcgcatgcag
atgcacaaggatggcgccctgtaccggtacttctccagaaatggttacaactacaccgat
cagttcggcgaatctccacaggaaggctctctcaccccgtttattcacaacgcattcaag
acagatgtgcaagtgtgcatccttgatggcgagatgatggcctacaacccaacgacacag
actttcatgcagaagggggtcaagtttgatatcaaaaggatggtcgaagattctgaccta
cagacatgctactgtgttttcgatgtgctgatggttaataataagaagctagggcgtgag
actctcaggaagaggtatgatatccttagtagcactttcacacccatacaaggtcgaata
gagatagtgcagaaaactcaagctcagacaaagcaggaagtagtggatgcattaaatgat
gccatagacaagagagaagaggggatcatggttaaacaccctctgtccatttacaagcca
gacaaaagaggtgaagggtggctaaagattaaaccagagtatgtcactggattgatggat
gaattagacctcttaattgttgggggctactggggtaaaggttctcgaggtggcatgatg
tctcactttctgtgtgcagtggcagagacaccacctcctggtgacaagccatctgtgttc
cacactctgtgccgtgttgggtcgggttacacgatgaaagaactctatgacctgggcttg
aaattggcaaaatactggaagcctttccaaagaaaatctccaccaagctgtattttgtgt
ggcacagagaagccagaagtgtacattgaaccccagaactctgtcatcgttcagatcaag
gcggcagagatcgtccccagtgacatgtacaagactggctctaccttgcgcttcccacgc
atcgagaagatcagagatgacaaagagtggcatgactgtatgacgctggatgacctggag
cagctgagggggaaagcatctgggaagcttgccacaaaacaccttcacataggtgacgat
gacgaacccagagaaaaaaggcggaaacccatctctaagacgaagaaaaccattggaatc
attgaacacctaaaagcgcctaacctttctaacataaacaaagtttctaatgtatttgaa
gatgttgagttttgtgtcatgagtggattagatggttatccaaagcctgacctagagaac
aaaattgcagaatttggtggttatatagtccagaatccaggcccagatacatactgtgtg
attgcaggttctgagaacattagggtcagaaacatcatctcttcagataggcatgatgtt
gtcaagcccgagtggcttttagagtgttttaaaacaaaaacatgtgtgccatggcaaccc
cgctttatgattcacatgtgcccatcaacaaagcagcattttgcccgtgaatatgactgc
tatggtgatagctatttcgttgatgcagatttggatcaattgaaagaagtgtttttaaga
attaaacccagtgagcagcagactcctgaagaaatggcccctgtgattgctgacctagaa
tgtcgttattcctgggatcactctcctctcagtatgtttcgacactacaccgtttatttg
gacttgtatgctgttattaatgacttaagttccaaaatcgaagccacaaggttaggtgtt
acagcacttgagctgcggtttcgtggagcaaaggtggtttcccgcttatctgaaggggtg
tctcacgtaatcatcggggaagatcagagacgagtcagtgactttaaaacgttcagaaga
acgcttaagaaaaagtttaaaatcctgcaggaacgttgggtgatcgattcagtagacaag
tgtgaactgcaggaagaaaacctgtatttgctttag

DBGET integrated database retrieval system