KEGG   Rattus norvegicus (rat): 291171
Entry
291171            CDS       T01003                                 

Gene name
Trim27, Rfp1
Definition
(RefSeq) tripartite motif-containing 27
  KO
K12009  tripartite motif-containing protein 27 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    291171 (Trim27)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     291171 (Trim27)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    291171 (Trim27)
SSDB
Motif
Pfam: PRY SPRY zf-B_box zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-RING_4 Baculo_IE-1 zf-RING_6
Other DBs
NCBI-GeneID: 291171
NCBI-ProteinID: NP_001128446
RGD: 1310105
Ensembl: ENSRNOG00000055917
UniProt: B5DFI5
Position
17q11
AA seq 513 aa
MASGSVAESLQQETTCPVCLQYFVEPMMLDCGHNICCACLARCWGAAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPDGEMGVCEKHREPLKLYCEQDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNRLDHLRRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSGLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcctcagggagcgtggccgagtccctgcagcaggagaccacctgccccgtgtgtctt
caatactttgtggaacccatgatgctcgactgcggccacaacatctgttgcgcgtgcctg
gcccgctgctggggtgccgcggagactaacgtgtcgtgcccgcagtgccgggagaccttc
ccgcagcgccacatgcggcccaaccggcacctggccaacgtgacccagctggtgaagcaa
ctgcgcaccgagcggccgtcggggccggacggcgagatgggcgtgtgcgagaagcaccgc
gagcctctgaagctgtactgcgagcaggaccagatgcccatctgcgtggtgtgcgaccgc
tcgcgcgagcaccgtggccacagcgtgctgccgctggaggaggctgtggaaggcttcaag
gagcaaatccagaatcggctggaccacctaagaagagtgaaagacttgaagaagagacgg
agggcacagggggagcaggcacgagctgagctcctgagcctgacccagatggagagggaa
aaaattgtttgggagtttgagcagctgtatcactctttgaaggaacatgagtatcgcctg
ttggctcgccttgaggagctagacttggccatctataatagcatcaacggtgccatcact
cagttctcctgcaacatctcccacctcagtggcctgattgcccaactggaagagaagcag
cagcagcccacgagggagctcttgcaggacattggagacactctgagcagggctgaaaga
atcaggatccctgagccctggatcacacctccagatctacaagagaaaatccatattttt
gcccaaaaatgtctgtttttgacagaaagtctaaaacagttcacagaaaaaatgcagtca
gatatggagaagatccaagagttgagagaggctcaattatactcagttgacgtgaccctg
gacccagacacagcctatcccagcctgattctttcagataatcttcggcaagtacggtac
agttacctccagcaggatcttccagacaaccctgagcggttcaatctgtttccctgtgtc
ttgggctctccatgtttcatcgctgggagacattactgggaggtagaggtgggcgataaa
gccaagtggaccataggtgtctgtgaagactcagtgtgcagaaaaggtggggtgacctca
gccccccagaatggattctgggcagtgtcattgtggtatgggaaagaatattgggctctt
acatccccgatgactgcactccccctgcggacccctctccagagggtagggattttcttg
gactatgatgctggtgaggtttccttctacaatgtgacagagagatgccatacctttact
ttctctcatgctaccttctgtgggccagtccggccctacttcagcctaagttactcggga
gggaagagtgcggctcctttgatcatctgccctatgagtgggattgatgggttttctggc
catgttgggaatcatggtcattccatggagacctctccttga

DBGET integrated database retrieval system