KEGG   Rattus norvegicus (rat): 291209
Entry
291209            CDS       T01003                                 

Gene name
Hecw1, RGD1561038
Definition
(RefSeq) HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
  KO
K12167  E3 ubiquitin-protein ligase HECW1 [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    291209 (Hecw1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     291209 (Hecw1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   291209 (Hecw1)
SSDB
Motif
Pfam: HECT HECW_N HECW1_helix WW C2 SKICH Keratin_B2_2
Other DBs
NCBI-GeneID: 291209
NCBI-ProteinID: NP_001099587
RGD: 1561038
Ensembl: ENSRNOG00000016046
UniProt: F1M4Q8
Position
17q12.1
AA seq 1594 aa
MNLYQNRFLGLAAMASPSRNSQSRRRCKEPLRYSYNPDQFHNIDIRNGAHDGITIPRSTS
DTDLVTSDSRSTLMVSSSYYSIGYSQDLVIHWDIKEEVDAGDWIGMYLIGEVSSENFLDY
KNRGVNGSHRGQIIWKIDASSYFVESETKICFKYYHGVSGALRATTPSVTVKNSAAPIFK
GIGSEETVQSQGNRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSIFPALPHHG
QERRSTIIGNTVNPIWQAEHFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGKLSMPVQRL
LERHAIGDRVVSYTLGRRLPTDHVSGHLQFRFEITSSIHADDEEISLNAEPESAEVQDSV
MNSVVENSSGEPPGDAAEFLKDLKPEAPSEEDGVRGSENENREHARPVEEAAGAMETRDD
SKFSEGPEEVGELQDPEQHDTQPTLSAEEVAERLPLGEGCPPSLLPEESTALGSKAEEEA
IPENGAGEEEMQEKGKDEEEEEGVSALEQGEPGLELRASVRKKSRPCSLPVSELETVIAS
ACGEAETPRTHYIRIHTLLHSMPSAQRGSTTEEEDAMEEESTLKESSEKDGLSEVDTIAA
DPQSMEDGENNGATLCMASSDCSGGHFSNLSKSIGAGQDGEAHPSTGSESDSSPQQGADH
SCEGCDASCCSPSCYSTSCYSSSCYSSSCYSSSCYNGNNRFASHTRFSSVDSAKISESTV
FSSQEDEEEENSAFESVPDSVQSPELDPESTNGAGPWQDELAAPGGNAARTTEGLDSPMA
GPSNRREGDCPMLHNSQPISQLPSLRPEHHHYPTIDEPLPPNWEARIDSHGRVFYVDHVN
RTTTWQRPSMAPTPDGMIRSGSVHQMEQLNRRYQNIQRTIATERSEEDSGNQSCEQIPDG
GAGGGGSDSEAESSQSNLDLRREGSLSPVNSQKVTLLLQSPAVKFITNPEFFTVLHANYS
AYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDHQG
KSFFVDHNSRATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEASEVSRNRGASLLA
RPGHSLIAAIRSQHQHESLPLAYNDKIVAFLRQPNIFEMLQERQPSLARNHTLREKIHYI
RTEGNHGLEKLSCDADLVILLSLFEEEIMSYVPLQSAFHPGYSFSPRCSPCSSPQNSPGL
QRASARAPSPYRRDFEAKLRNFYRKLEAKGFGQGPGKIKLIIRRDHLLEGTFNQVMAYSR
KELQRNKLYITFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSANDTYTVQISPMSA
FVENYLEWFRFSGRILGLALIHQYLLDAFFTRPFYKGLLKLPCDLSDLEYLDEEFHQSLQ
WMKDNNITDILDLTFTVNEEVFGQVTERELKSGGANTQVTEKNKKEYIERMVKWRVERGV
VQQTEALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNTEYRGGYHDGHLVI
RWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCIEKWGKITSLPRAH
TCFNRLDLPPYPSYSTLYEKLLTAVEETSTFGLE
NT seq 4785 nt   +upstreamnt  +downstreamnt
atgaatctgtaccagaacaggtttttaggcctggctgccatggcatctccatctagaaac
tcccagagccgacgccggtgcaaagagcccctccggtacagctataacccagaccaattc
cacaacatagacatcagaaatggtgcccatgatggcatcaccatccctcgctctaccagt
gacactgacctggtcacctcagacagccgctctacactcatggtcagcagttcctactat
tctatagggtattcccaggatttggtgatccactgggacatcaaggaagaagtggatgcc
ggagactggattgggatgtaccttattggtgaagtctcatctgaaaactttctggactat
aagaaccgtggagtcaatggatctcacagaggccagatcatttggaagattgatgccagc
tcttactttgtggaatctgaaactaagatctgcttcaaatactaccacggagtaagcggg
gccctgagagctacaacccccagtgtcactgtcaagaactcagcggctcctatttttaaa
ggtattggctctgaggagactgtgcaaagtcaaggaaacaggaggctcatcagcttctct
ctctcagatttccaggccatgggattgaagaaagggatgtttttcaacccagacccttat
ctgaagatttccattcaacctggtaaacatagcatcttcccggccctccctcatcatgga
caggaacggagatccacgatcataggcaacactgtaaaccccatctggcaggcagagcat
ttcagtttcgtgtctctgccaactgatgtgctggaaattgaagtgaaggacaagtttgcc
aagagtcgtcccatcatcaagcgtttcttgggaaagctgtcaatgccagttcagaggcta
ctggagagacatgccataggggatagggtggtcagctacacacttggccgcaggcttcca
actgaccatgtgagtggacatctgcaattccgatttgagatcacatcctccatccacgca
gacgatgaagagatctctctgaatgctgagcctgagtcagcggaagtgcaggacagtgtc
atgaatagtgtggtggaaaacagcagtggggagcctcccggtgatgctgcagaattcctc
aaggacttgaagccagaggcaccgagtgaagaggatggagtgcgcggctcagaaaatgaa
aaccgagagcatgccaggccagtcgaggaagctgcgggtgctatggagaccagagatgat
agcaagttctctgaaggaccggaagaggttggagagcttcaggacccagagcaacatgac
acccagcccactctgagcgcagaagaagtggcagagcgacttcccctgggtgagggttgc
ccaccctcgctgttgccagaagagagtacagctctaggcagcaaggcagaagaggaagca
attccagaaaatggagcgggagaggaagagatgcaggagaaggggaaagatgaggaggaa
gaagagggtgtttctgccctggagcaaggagagcctggacttgagctgagggcctccgtg
agaaaaaaaagcaggccatgttccttacctgtatccgagcttgaaacagtgatcgcatct
gcctgtggagaggctgagaccccaaggacccactacatccgcatccacaccctactgcac
agcatgccctcggcccagaggggaagcaccacagaggaggaggatgccatggaggaggaa
tccaccctcaaggagtcctctgaaaaggatgggctcagcgaggtggacacaatagctgct
gacccacagtccatggaagatggcgagaacaatggcgctactctctgcatggcatcctct
gactgctctgggggccatttctccaatttatctaaaagcattggcgctggccaagatggc
gaagctcaccccagcactgggagtgagagtgactccagcccccagcagggagcagaccac
agttgcgagggctgtgatgcctcatgctgtagcccctcatgctatagcacatcgtgctac
agcagctcctgttatagcagctcctgttacagcagctcctgctacaatggcaacaatcgg
tttgccagccacacacgcttctcctcggtggacagcgccaagatctctgagagcacagtc
ttttcttcacaagaggatgaggaggaggaaaacagtgcattcgagtcggtacctgactcg
gtgcaaagcccagagctagatcccgagtctacaaatggggctgggccttggcaggatgaa
ctggctgcccctggtgggaatgcagcaagaactactgaaggtctggactcccccatggca
ggccctagcaataggagagaaggtgactgtcctatgctccataattcccagccaataagc
cagcttccttccttgaggcctgaacatcatcactacccaacaatcgatgagcctcttcca
ccaaactgggaagctcgaatcgacagccatggacgggtcttttatgtggaccatgtaaat
cgcacaaccacctggcagcgaccatcaatggcgcctaccccagatggaatgatcagatcc
gggtctgtccaccagatggagcagcttaacagaaggtatcaaaacatccagagaaccatt
gcaacagagagatctgaagaagattctggcaaccaaagctgtgagcaaataccagacgga
ggagctggaggtggagggagtgactcggaagcagaatcttcccaatcaaacttagatctg
aggagagaagggtcactttctcctgtcaactcacagaaggtcaccttgctgctgcagtct
ccagcagtcaagttcatcaccaatcctgagttcttcactgtgttgcatgccaattatagt
gcctacagggtttttacaagtagcacttgcctgaagcatatgattttgaaagtccgaaga
gatgctcgcaattttgaacgctaccagcacaaccgggacctggtgaatttcatcaacatg
tttgcagatactcggctggaactgccccggggttgggagatcaaaactgatcatcaggga
aagtctttctttgtggaccacaacagtcgggctactactttcattgatccccgaatccct
cttcagaatggccgccttcccaatcatctaacccaccgacagcacctccagaggctcagg
agttacagtgctggtgaggcctcagaagtctctagaaacagaggagcatctttgctggcc
agaccaggacacagcctaatagctgctattcggagccaacatcaacacgagtccttgcca
ctggcatacaatgacaagattgtggcatttcttcgacagccaaacatttttgaaatgcta
caagaacgtcagccaagcttggcaagaaaccacacactcagggagaaaatccattatatt
cggacagagggcaatcatggacttgagaaattgtcctgtgatgcagatctagtcattttg
ctaagtctctttgaagaagagatcatgtcctatgtccccctgcaatctgcctttcaccct
ggatatagcttctctccccgctgttcaccctgttcctcaccccagaactccccaggttta
cagagagccagtgccagggccccttcaccgtaccgaagggattttgaagctaagctccgc
aatttctaccgaaaactggaagccaaaggatttgggcagggtccgggtaaaattaagctc
atcatccgtcgagaccacttgttggaggggaccttcaatcaggtgatggcatactctcgg
aaggagctccagagaaacaagctctacatcacctttgttggagaggaggggctggactac
agtggcccttctcgagagttcttcttcctgttgtctcaggagctcttcaacccttactat
ggactctttgagtattctgcaaatgacacttacacagtgcagatcagccccatgtcggcg
tttgtagaaaattatctcgaatggtttagattcagcggccgtatcctgggcctagctctg
atccaccagtacctcttggatgctttcttcaccagacccttctataagggactcctgaag
ctgccatgcgatctgagtgacctggaatacttggatgaggaattccaccagagtttacag
tggatgaaggacaacaacatcacagatattcttgacctcactttcactgttaacgaagaa
gtttttggacaggtaacagaaagagagttgaagtctggaggtgccaacacgcaggtgact
gagaagaacaagaaggagtacatcgagaggatggtgaagtggcgtgtagagcgtggtgtg
gtacagcagaccgaggcattggtcaggggtttctatgaggttgtagactcaaggcttgtc
tcagtgtttgacgcgagggagctggagctggtaatcgcgggaactgctgaaatcgacctg
aatgactggaggaataacactgagtaccggggaggttatcatgatggccaccttgtgatc
cgctggttctgggctgcagtggagcgcttcaataatgagcagagattgagattacttcag
tttgtgacaggaacgtcgagtgttccctatgaaggctttgcagctctgcgggggagcaat
gggcttcgaaggttctgcatagagaagtgggggaagattacatctcttcccagggcacat
acatgcttcaaccgactggatctcccaccgtatccttcatactccacattgtatgaaaag
ttgttaacagcagttgaagaaaccagcacctttggacttgagtga

DBGET integrated database retrieval system