KEGG   Rattus norvegicus (rat): 291245
Entry
291245            CDS       T01003                                 

Gene name
Actn2
Definition
(RefSeq) actinin alpha 2
  KO
K21073  actinin alpha 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    291245 (Actn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    291245 (Actn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    291245 (Actn2)
   04147 Exosome [BR:rno04147]
    291245 (Actn2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    291245 (Actn2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     291245 (Actn2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   291245 (Actn2)
  Exosomal proteins of colorectal cancer cells
   291245 (Actn2)
  Exosomal proteins of bladder cancer cells
   291245 (Actn2)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen CAMSAP_CH EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 XisI EF-hand_11 HisKA_2
Other DBs
NCBI-GeneID: 291245
NCBI-ProteinID: NP_001163796
RGD: 1308097
Ensembl: ENSRNOG00000017833
UniProt: D3ZCV0
Position
17q12.1
AA seq 894 aa
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSILAIQNEVEKVIQSYSIRISSSNPYS
TVTMDELRNKWDKVKQLVPVRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPPYSGPGSVPGALDYTAFSSALYGESDL
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgaatcagatagagcccggcgtgcagtacaactatgtctacgacgaagatgagtacatg
atccaggaggaggagtgggaccgcgacctgctcctcgacccggcctgggagaagcagcag
aggaagactttcactgcctggtgcaactcgcacctgcgcaaagccggcacccagatcgag
aacatagaggaggatttcaggaatggcctcaagctcatgctgcttctggaagtcatctca
ggggaaaggcttcccaaacctgaccggggcaaaatgcggttccacaagattgcgaatgtc
aacaaggctttggattacatagccagcaagggagtgaaattggtatctattggggctgaa
gaaatcgtcgatggcaatgtgaagatgaccctgggtatgatctggaccatcatcctccgc
ttcgccattcaggacatctcagtggaagaaacatctgccaaagagggcctgctgctatgg
tgtcagaggaagacagcaccataccgaaatgtgaacatccagaacttccacaccagctgg
aaagatggccttggactctgtgccctcatccacagacaccggcctgacctcatcgactac
tcaaagcttaacaaggatgaccccataggaaacattaacctggccatggaaatagcagag
aagcacttggatatccctaaaatgttggatgctgaagacattgtcaacactcccaaaccc
gatgaaagagccatcatgacttacgtttcctgcttctaccatgctttcgcgggagcggag
caggccgagacggcagctaacaggatatgtaaggttcttgctgtgaatcaagagaatgag
aggctgatggaagaatatgagaggctagcgagtgagctcttggaatggattcgacgcaca
atcccctggctggagaacaggacaccggagaagaccatgcaagccatgcagaagaagctg
gaggacttccgggactatcgtcgtaagcacaagcccccaaaggtgcaggagaagtgccag
ctggagatcaacttcaacaccctgcagaccaagcttcggatcagcaaccggcctgccttc
atgccctccgagggcaagatggtgtcggacattgctggtgcctggcagaggttggagcag
gccgagaagggctatgaggaatggctattgaatgagattcgaagactggagcgcttggag
cacttggctgagaagttcaggcagaaggcctccacccatgagacatgggcttacggcaaa
gaacagatcttgctgcagaaggactatgagtctgcgtccctgacggaagttcgagcccta
cttcggaagcacgaggcctttgagagtgacctggcggcacaccaggatcgtgtggaacag
attgcagccattgctcaggagctcaatgaactggactaccacgatgctgtgaacgtcaat
gatcgttgccagaaaatttgcgaccagtgggatagattggggacgctcacccagaagagg
agggaggccttggagagaaccgagaagttgctagaaacaattgaccagctgcacctggag
tttgccaagagagctgcgcccttcaacaactggatggagggcgccatggaggacctgcag
gacatgttcatcgtccacagcattgaggagatccagagtctgatcaccgcacatgagcag
ttcaaggccacgctgcccgaggccgatggggagcggcagtccatcctagccatccagaat
gaggtggagaaggtgatccagagctacagtatccggatcagctccagcaacccctacagc
actgtcaccatggacgagctgcgcaacaagtgggacaaggtgaagcagctggtgccagtc
cgggatcagtccctgcaggaggagctggcacgccaacatgctaatgagcgcctacggcgc
cagtttgctgcccaggccaatgccatcggcccctggatccagaacaagatggaggagatc
gctcggagctccatccagatcacaggggccctggaggaccagatgaaccagctgaagcag
tacgagcacaacatcatcaactacaagaacaacattgacaagctggagggcgaccaccag
ctcatccaggaagccctggtcttcgacaacaagcacaccaactacaccatggagcatatc
cgtgtcggatgggagttgctgctcacaactatcgccagaaccatcaatgaggtggagacc
cagatcctgacaagagatgccaagggcatcacccaggagcagatgaatgagttcagagcc
tccttcaaccactttgacaggaggaagaatggcctgatggatcatgaggatttcagagcc
tgcctcatttccatgggctatgacttgggtgaagctgagtttgcccgaattatgactctg
gttgaccccaacggacaaggcacggtcaccttccagtccttcattgacttcatgactaga
gagaccgcagacacggacactgcagaacaggtcatcgcctccttccggattctggcttct
gataagccttacatcttggcagaggaacttcgtcgagagctgcctccggatcaggcccag
tactgcatcaagagaatgcccccatactcaggcccaggcagtgtccccggggccctggac
tacactgccttctcctctgccctctacggggagagcgacctctga

DBGET integrated database retrieval system