KEGG   Rattus norvegicus (rat): 29135
Entry
29135             CDS       T01003                                 

Gene name
Hpn
Definition
(RefSeq) hepsin
  KO
K08665  hepsin [EC:3.4.21.106]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    29135 (Hpn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29135 (Hpn)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.106  hepsin
     29135 (Hpn)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   29135 (Hpn)
SSDB
Motif
Pfam: Trypsin Hepsin-SRCR SRCR_2 DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 29135
NCBI-ProteinID: NP_058808
RGD: 61982
Ensembl: ENSRNOG00000021097
UniProt: Q05511
Position
1q21
AA seq 416 aa
MAKEGGRTAPCCSRPKVAALTVGTLLFLTGIGAASWAIVTILLRSDQEPLYQVQLSPGDS
RLLVLDKTEGTWRLLCSSRSNARVAGLGCEEMGFLRALAHSELDVRTAGANGTSGFFCVD
EGGLPLAQRLLDVISVCDCPRGRFLTATCQDCGRRKLPVDRIVGGQDSSLGRWPWQVSLR
YDGTHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVARTSPHAVQLGVQAVIYHG
GYLPFRDPTIDENSNDIALVHLSSSLPLTEYIQPVCLPAAGQALVDGKVCTVTGWGNTQF
YGQQAVVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGHFVCED
RISGTSRWRLCGIVSWGTGCALARKPGVYTKVIDFREWIFQAIKTHSEATGMVTQP
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcgaaggagggtggccggactgcaccatgctgttccagacccaaggtggcagctctc
actgtggggaccctgctgttcctgacaggcattggggctgcgtcctgggccattgtgacc
atcctactacggagtgaccaggagccactgtaccaagtgcagctcagtcccggggactct
cgacttttggtgttggacaagacagagggaacgtggaggctgctgtgctcctcacgctcc
aacgccagggtagcagggctcggctgtgaggagatgggctttctcagggctctggcgcac
tcagagctggatgtgcgaaccgcgggcgccaacggcacatcgggcttcttctgcgtggac
gagggcggtctgcctctggctcagcggttgctggatgtcatctctgtatgcgactgtcct
agaggccgattcctgactgccacctgccaagactgtggccgcaggaagctgccggtggat
cgcattgtggggggccaggacagcagcctgggaagatggccatggcaggtcagcctgcgt
tatgatgggacccacctctgtgggggatccctgctgtccggggactgggtactgaccgct
gcacactgctttccagagaggaaccgggtcctgtctcggtggcgagtatttgctggtgct
gtagcccggacctcacctcatgccgtgcagctgggggttcaggctgtgatctatcatggg
ggctaccttccctttcgagaccctactatcgacgaaaacagcaatgacattgccctggtc
cacctctctagctccctgcctctcacagaatacatccagccggtttgtctccctgctgcg
ggacaggccctggtggacggcaaggtctgtacagtgaccggctggggtaacacacagttc
tatggccagcaagctgtggtgctccaagaggcccgggtccccatcataagcaacgaagtt
tgcaacagccccgacttctacgggaatcagatcaaacccaagatgttctgtgctggctat
cctgagggtggtattgatgcatgccagggtgacagcggaggccactttgtatgtgaggac
agaatctctggaacatcaagatggcggctctgcggcattgtaagctggggtacgggctgt
gctttggcccggaagccgggagtgtacaccaaagtcattgacttccgggagtggatcttc
caggccataaagactcactccgaagctaccggcatggtaactcagccctga

DBGET integrated database retrieval system