KEGG   Rattus norvegicus (rat): 29144
Entry
29144             CDS       T01003                                 

Gene name
Canx
Definition
(RefSeq) calnexin precursor
  KO
K08054  calnexin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
rno04612  Antigen processing and presentation
rno04918  Thyroid hormone synthesis
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29144 (Canx)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29144 (Canx)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    29144 (Canx)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    29144 (Canx)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29144 (Canx)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    29144 (Canx)
   04131 Membrane trafficking [BR:rno04131]
    29144 (Canx)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    29144 (Canx)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   29144 (Canx)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    29144 (Canx)
Lectins [BR:rno04091]
 Calnexin / calreticulin
  29144 (Canx)
SSDB
Motif
Pfam: Calreticulin Connexin TRAP_alpha MAP17 COX16 V_ATPase_I Folate_carrier Astro_capsid_p
Other DBs
NCBI-GeneID: 29144
NCBI-ProteinID: NP_742005
RGD: 2266
Ensembl: ENSRNOG00000003343
UniProt: P35565
Position
10
AA seq 591 aa
MEGKWLLCLLLVLGTAAIQAHDGHDDDMIDIEDDLDDVIEEVEDSKSKSDTSTPPSPKVT
YKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSELNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAV
KPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPF
SAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAEE
RPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKGDE
EEEEEKLEEKQKSDAEEDGGTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggaagggaagtggttactgtgtttgctactggtccttggaactgcagctattcaggct
catgatggacatgatgatgacatgattgatattgaagatgatcttgatgatgttatcgaa
gaggtagaagattcaaaatctaaatcagataccagcactcctccatctccaaaggtcacc
tacaaagctccagttccaacaggggaggtttattttgctgactcctttgacagagggtct
ctgtcagggtggattttatctaaagccaaaaaagacgacactgatgatgaaattgccaaa
tatgacggaaagtgggaggtagatgaaatgaaggaaacaaagcttccaggtgataaagga
cttgtattgatgtctcgggccaagcatcatgccatctctgctaaactgaacaagcccttc
ctgtttgataccaagcctctcattgttcagtatgaggttaactttcagaatggaatagaa
tgcggtggtgcctacgtgaagctgctatccaagacctcagaactcaacctggatcaattc
cacgacaagactccgtatactattatgtttggtccagataaatgtggagaggactacaaa
ctgcatttcatctttcgccacaaaaaccccaagacaggtgtatatgaagaaaaacatgct
aagaggccagatgcagatctgaagacctatttcactgacaagaaaacacatctttacaca
ttaatcttgaatccagacaatagttttgaaatattagttgaccagtctgttgtgaacagt
ggaaacctgctaaatgacatgacccctccggtaaacccttcacgtgaaattgaggaccca
gaagaccggaagcctgaagattgggatgaaaggcccaaaatagcagatccagatgctgtc
aagccagatgactgggatgaagatgccccttctaagattccagatgaagaggccacaaag
cctgaaggctggttagatgatgaacccgagtatattccagaccctgatgcagagaaacca
gaagattgggatgaggatatggacggagaatgggaggctcctcagattgccaaccctaag
tgtgagtccgcccctgggtgtggtgtctggcagcgacctatgattgacaaccccaattat
aagggcaaatggaagcctcctatgattgacaatcctaactaccagggaatctggaaacca
aggaaaataccaaatccagatttctttgaagacctggaaccttttaggatgactcctttc
agcgctattggtttggagctctggtccatgacatccgacatcttttttgacaactttatc
attagtggtgaccgaagagtagttgatgactgggccaatgatgggtggggcctgaagaaa
gctgctgatggggctgcagagccaggtgtagtggggcagatgctggaggcagctgaagag
cgtccatggctttgggtggtctacattctgactgtagcgttgccagtgttccttgtgatc
ctcttctgctgttctggaaagaaacagtccaatgctatggagtacaagaagacagatgct
ccccagccagatgtgaaggacgaagaagggaaggaagaagagaagaacaagggagatgaa
gaggaagaagaggagaagcttgaagagaaacagaagagtgatgctgaagaagatggtggc
actggcagtcaagatgaggaagatagcaagcctaaagcagaggaggatgaaattttgaac
agatcaccaagaaacagaaagccacgaagagagtga

DBGET integrated database retrieval system