KEGG   Rattus norvegicus (rat): 291445
Entry
291445            CDS       T01003                                 

Gene name
Megf10
Definition
(RefSeq) multiple EGF-like domains 10
  KO
K24068  multiple epidermal growth factor-like domains protein 10/11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    291445 (Megf10)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    291445 (Megf10)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Others
    291445 (Megf10)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   291445 (Megf10)
SSDB
Motif
Pfam: Laminin_EGF hEGF EGF_2 Syndecan Baculo_11_kDa
Other DBs
NCBI-GeneID: 291445
NCBI-ProteinID: NP_001094127
RGD: 735084
Ensembl: ENSRNOG00000013674
UniProt: F1MAP4
Position
18q12.1
AA seq 1145 aa
MAISSSSCLGLICSLLCHWLRAASSLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRVSYRTAYRHGEKTMYRRKSQCCPGFYESRDVCVPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDGDHWGPHCSSRCQCKNRALCNPITGACHCAAGYRGWRCED
RCEQGTYGNDCHQRCQCQNGATCDHITGECRCSPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGACDAATGQCHCSP
GYTGERCQDECPVGTYGVRCAETCRCVNGGKCYHVSGTCLCEAGFSGEFCEARLCPEGLY
GIKCDKRCPCHLDNTHSCHPMSGECGCKPGWSGLYCNETCSPGFYGEACQQICSCQNGAD
CDSVSGRCACAPGFKGTDCSTPCPLGRYGINCSSRCGCKNDAVCSPVDGSCICKAGWHGV
DCSISCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKCEFPCQDGTYGLNCAE
RCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGVCTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALVCQCQNGADCDHISGQCTCRTGF
MGRHCEQKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPADSYQIGAIAGIVVLLLVVLFLLALFVIYRHKQKRKESSMPAVTYTPAMR
VINADYTIAETLPHSNGGNANSHYFTNPSYHTLSQCAASPHVNNRDRMTIAKSKNNQLFV
NLKNVNPGKRGALVDCTGTLPADWKQGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSST
CSLSSSENPYATIKDPPALLPKSSECGYVEMKSPARRDSPYAEINNSTSANRNVYEVEPT
VSVVQGVFSNNGHVTQDPYDLPKNSHIPCHYDLLPVRDSSSSPKREDGGGSSSSTTTSNS
SNSSE
NT seq 3438 nt   +upstreamnt  +downstreamnt
atggctatttcttcaagctcctgcctgggcctcatctgctcactgctgtgccactggctg
agggcagcatcctcactgaacctggaagaccccaatgtatgcagccactgggaaagctac
tcagtgactgtgcaggagtcttacccacatcccttcgatcagatttactacacaagctgc
actgacatactgaactggtttaaatgcactcggcacagagtgagctaccggacagcctac
cgccatggggagaaaaccatgtacagacgcaaatcccagtgttgccccggattttatgaa
agtcgagacgtgtgtgtccctcactgcgctgataaatgcgtccacggtcgctgcatcgct
ccaaacacctgtcagtgtgagcctggctggggtgggaccaactgtagcagtgcttgtgac
ggtgatcactggggacctcactgcagcagccggtgtcagtgcaaaaacagagctttgtgt
aaccccatcaccggagcttgtcactgcgccgcgggctaccggggatggcgctgtgaggac
cgttgtgaacagggcacctacggtaacgactgtcatcaaaggtgccagtgtcagaatgga
gcgacctgtgaccacatcactggggaatgtcgttgttcacctggatacactggagccttc
tgtgaggatctgtgtcctcctggcaaacatggcccacagtgtgagcagagatgtccctgc
caaaatggaggcgtgtgccatcatgtcactggagagtgctcctgcccttctggctggatg
ggcacagtgtgtggtcagccctgccccgagggtcgctttggaaagaactgttcccaagaa
tgtcagtgccacaatggaggagcgtgtgatgctgccacaggccaatgtcactgcagccca
ggatacacaggggaacggtgtcaggatgaatgtcctgttggaacctatggagttcgctgt
gctgagacctgcaggtgtgttaatggagggaagtgttaccatgtgagcggcacatgccta
tgcgaagcaggtttttcaggtgaattttgcgaggctcgtctgtgccctgaggggctttac
ggcatcaaatgtgacaagcggtgcccctgccacctggacaatactcatagctgtcatccc
atgtctggagagtgtggctgcaagccgggttggtctggactgtactgtaatgaaacatgc
tctcctggattctacggggaagcttgccaacagatctgcagctgccaaaacggggctgac
tgtgacagtgtgagtggaaggtgtgcctgtgctccaggattcaaaggaactgactgctct
actccgtgtcctctgggacgctatgggataaattgttcttctcgctgtggctgtaaaaac
gatgctgtctgttctcctgtggatggatcgtgcatctgtaaggcaggctggcacggggtg
gactgttccatcagctgccccagtggcacatggggctttggctgtaatctaacctgtcag
tgcctcaatggcggtgcctgcaacacactggacggcacctgcacctgtgcgccgggatgg
cgaggggagaaatgtgaatttccctgccaggatggcacatatgggctgaactgtgctgag
cgctgtgactgcagccatgcagacggatgtcaccccactaccggccattgccgatgcctc
cctggatggtcaggtgtgcactgtgacagtgtgtgtgctgagggacgctggggtcctaac
tgctcgctgccctgctactgtaaaaatggggcttcgtgttctcccgatgatggcatctgt
gaatgcgcacccggattccgaggcaccacttgccagagaatctgctccccgggcttttat
ggacaccgctgtagccagacatgcccacagtgtgtgcacagcagtggaccatgccaccac
atcacaggcctgtgtgactgcttgcctggcttcactggcgccctgtgcaatgaagtgtgt
cccagtggcagatttgggaagaactgtgcaggtgtttgtacctgcaccaacaacggcacc
tgtaaccccatcgaccggtcctgtcagtgctacccaggctggattggcagtgactgctcc
cagccctgtccaccagcccactggggtccgaactgcatccatacatgcaactgccacaat
ggagccttttgcagcgcctatgatggggaatgcaaatgcactcctggctggacggggctc
tactgcactcagagatgccctctgggcttctatggcaaggactgtgcactggtatgccaa
tgtcaaaacggagctgactgcgaccacatctcggggcagtgtacctgccgcacgggattc
atgggacggcactgtgaacagaaatgccctgcgggaacatacggctatggctgtcgccag
atctgcgactgtctgaacaactccacctgtgaccacatcaccggcacgtgttactgtagc
ccagggtggaaaggagcacgatgtgaccaagctggggtcatcatcgtgggcaatctgaac
agcttaagcaggaccagcaccgcccttcctgctgactcctatcagattggggccatcgcg
ggcatcgtggtccttctgcttgttgtgctcttcctgctggcgctgttcgttatctacaga
cacaagcagaagaggaaggaatcgagcatgccggccgtgacctacacccctgccatgagg
gttatcaatgcagactataccattgcagaaaccctgcctcacagcaatggcggaaatgcc
aacagccactacttcaccaatcccagttatcacacacttagccagtgtgccgcgtcccct
catgtgaacaacagggacaggatgaccattgcaaagtcaaaaaacaatcaactgtttgtg
aatcttaaaaatgtgaatccagggaagagaggcgctttggtggactgcactgggacgttg
ccagctgactggaagcaaggaggctacctcaatgaacttggtgcttttgggctggacaga
agctacatgggaaagtccttaaaagatctggggaagaattctgagtacaattcaagtact
tgttccctaagcagctcggagaacccatatgccaccattaaagaccctcctgcgctcttg
cctaaaagctccgagtgtggctacgtggagatgaagtcgccagcgcgaagagactcccca
tatgcagagatcaataactcaacttcagccaacaggaatgtctatgaagtcgaacctaca
gtcagtgtggtgcaaggagtattcagcaacaatggtcatgtcacccaagacccatatgac
cttccaaagaacagtcacatcccttgccattatgacctgctgccagtaagggacagttca
tcctccccaaagagagaggatggtggtggcagcagcagcagcaccaccaccagcaacagc
agcaacagcagcgaatga

DBGET integrated database retrieval system