KEGG   Rattus norvegicus (rat): 291580
Entry
291580            CDS       T01003                                 

Gene name
RGD1312005
Definition
(RefSeq) similar to DD1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MINAR1_C Chordopox_A33R
Other DBs
NCBI-GeneID: 291580
NCBI-ProteinID: NP_001099614
RGD: 1312005
Ensembl: ENSRNOG00000022429
UniProt: F7EQ04 B2GUX6
Position
18q12.1
AA seq 193 aa
MKGDMDLSVLPNNNHPDKFLQLDVKSLMRSSTLLQASLARFPGGNYPATQHWQNLVYSQG
EKNIATQRIKGFGGENPVLPESPPASMSSVMKNNPLYGDVSLEEAMEERKKNPSWTIEEY
NKHSVHSNLSGHLKENPNDLRFWLGDMYTPGFDTLLKKKKKRNKRSKLCHMGLILLVVSS
ILVTVVTLSALFA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaaaggggacatggatctttctgttttgcccaataacaaccaccctgacaaattcctg
cagcttgacgtgaagtctttaatgaggagctcaacccttctgcaggctagcctcgcgaga
tttccgggtggaaattatcccgctacacagcactggcaaaaccttgtctactcacaggga
gaaaagaacattgctactcaacgaatcaagggatttggtggggagaacccagtccttcct
gaaagccctcccgcatccatgtcttcagtgatgaagaacaacccgttgtatggtgacgtg
agtttggaagaagccatggaagaacggaaaaagaatccttcatggaccattgaggaatac
aacaagcactctgtgcattccaatctctctggacatctgaaggaaaaccccaatgacctg
cgcttttggttgggggacatgtatactccaggctttgacactttgctgaagaagaaaaag
aaacgcaacaagcgatcaaaattatgtcacatgggtctgattttactcgtcgtgtcctcc
atcctggttaccgtagtgactctcagcgctttattcgcttaa

DBGET integrated database retrieval system